Protein Family IF06812

Metagenome Isolate
131 Members
44 Samples
126 Scaffolds
336.18 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_120340|Ga0466722_120340_109_1266
Length
385 aa
Sequence
VHPHIHTSITQDLRKRKTSCRAHTGGKAGENGDALNCWPPPRLLEKTGTSGYFGSMSLTEPEQQPAALVLTKEEEWLVGDIEKWLKDKNPLDFELVQERFLRLRNLGVAVSDYPSIRNTQFLKGIIRDENQLAESLLGFSTASSHLLRIPTKVVAFRSFLVAKFHAFSLLSYLIAENPGFFAAVKGVIFSVICTLMAEDVYFSCLEDSGFSRNTKSRLADDLIALWDSGIDPRGIRHLSALSALWIARDAAPPSFGTMDGNTELLRISIDMDRDWQEFLIEESTNDETRWALEEFLFGLSYEEIQQVRSRLKRYGISAVGYDEIRSYLGSRPSYSVVNDRDPRAIYDFFIERKDACILRKRVNAPGPRHTLEEIYLKYRIILEIR

📊 Sample Types

Isolate 3.8%
Metagenome 96.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.6%
Kalotermitidae 34.1%
Unclassified 14.6%
Rhinotermitidae 7.3%
Termopsidae 7.3%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
2 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
3 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
4 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
5 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
6 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
7 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
8 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
21 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
22 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
23 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
24 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
35 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
38 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
41 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466723_177039 3300042618 Bacteria 3799
2 Ga0466728_305002 3300042620 Bacteria 10273
3 Ga0466720_229384 3300042607 Bacteria 3608
4 Ga0264413_130951 3300024493 Bacteria 1717
5 Ga0466695_013771 3300042595 Bacteria 1122
6 Ga0466709_319989 3300042648 Bacteria 3113
7 Ga0466708_039890 3300042652 Bacteria 6374
8 Ga0466708_090691 3300042652 Unclassified 4573
9 JGI24698J34947_10014273 3300002449 Bacteria 4326
10 JGI24698J34947_10015693 3300002449 Bacteria 4120
11 JGI24695J34938_10006663 3300002450 Unclassified 6886
12 Ga0466705_390380 3300042612 Bacteria 4050
13 Ga0466718_012956 3300042617 Bacteria 13057
14 Ga0466718_139367 3300042617 Bacteria 3256
15 Ga0466718_140799 3300042617 Bacteria 2256
16 Ga0466718_153942 3300042617 Bacteria 1974
17 Ga0466723_006055 3300042618 Bacteria 37836
18 Ga0466716_169196 3300042605 Bacteria 1556
19 Ga0466720_011964 3300042607 Bacteria 11141
20 Ga0466720_068889 3300042607 Bacteria 7067
21 Ga0415639_226299 3300038395 Bacteria 1317
22 Ga0466692_044675 3300042591 Bacteria 4555
23 Ga0466691_225487 3300042593 Bacteria 2917
24 Ga0466694_053698 3300042594 Bacteria 31827
25 Ga0466694_367398 3300042594 Bacteria 2350
26 Ga0466730_037164 3300042625 Bacteria 1122
27 Ga0466704_063778 3300042643 Bacteria 17590
28 Ga0466708_138493 3300042652 Bacteria 3923
29 Ga0466708_389279 3300042652 Bacteria 3839
30 JGI24695J34938_10000178 3300002450 Bacteria 59181
31 JGI24695J34938_10060300 3300002450 Bacteria 1619
32 Ga0466705_187537 3300042612 Bacteria 5340
33 Ga0466715_441827 3300042616 Bacteria 4451
34 Ga0123356_10000080 3300010049 Bacteria 102921
35 Ga0123356_10567867 3300010049 Bacteria 1297
36 Ga0466720_096726 3300042607 Bacteria 11589
37 Ga0466722_019023 3300042609 Bacteria 8953
38 Ga0415639_046080 3300038395 Bacteria 4330
39 Ga0456237_0004104 3300041968 Bacteria 2343
40 Ga0466690_396470 3300042590 Bacteria 2430
41 Ga0466691_045966 3300042593 Bacteria 2671
42 Ga0466696_015142 3300042596 Bacteria 3494
43 Ga0466696_133174 3300042596 Bacteria 3478
44 Ga0466731_421190 3300042622 Bacteria 1248
45 Ga0466703_323924 3300042636 Bacteria 4517
46 Ga0466704_325976 3300042643 Unclassified 9064
47 Ga0466704_589271 3300042643 Bacteria 4755
48 Ga0466709_145786 3300042648 Bacteria 2374
49 Ga0466727_170492 3300042655 Bacteria 2414
50 Ga0072941_1108220 3300005201 Bacteria 2149
51 Ga0466712_059979 3300042614 Bacteria 8666
52 Ga0466715_116575 3300042616 Bacteria 4447
53 Ga0466715_555289 3300042616 Bacteria 2355
54 Ga0466726_132996 3300042619 Bacteria 14822
55 Ga0466719_130416 3300042606 Bacteria 1522
56 Ga0466722_053775 3300042609 Bacteria 9322
57 Ga0466692_096271 3300042591 Bacteria 1802
58 Ga0466694_154582 3300042594 Bacteria 9726
59 Ga0466735_196552 3300042624 Bacteria 20904
60 Ga0466702_194927 3300042635 Bacteria 2181
61 Ga0466704_177650 3300042643 Bacteria 16434
62 Ga0466709_021132 3300042648 Bacteria 11477
63 Ga0466708_064385 3300042652 Bacteria 3792
64 Ga0466708_065662 3300042652 Unclassified 4503
65 Ga0466727_344986 3300042655 Bacteria 2037
66 AustNasuHG_c1023555 3300000089 Bacteria 1963
67 AustNasuHG_c1040308 3300000089 Bacteria 1144
68 JGI24698J34947_10056871 3300002449 Bacteria 1943
69 JGI24695J34938_10043357 3300002450 Bacteria 2007
70 Ga0466705_061756 3300042612 Bacteria 3518
71 Ga0466715_084371 3300042616 Bacteria 11174
72 Ga0466723_102951 3300042618 Bacteria 2798
73 Ga0123356_10002217 3300010049 Bacteria 20923
74 Ga0123356_10003713 3300010049 Bacteria 15904
75 Ga0123356_10004605 3300010049 Bacteria 14210
76 Ga0466700_153348 3300042600 Bacteria 12519
77 Ga0466719_340198 3300042606 Bacteria 1973
78 Ga0466722_112156 3300042609 Bacteria 1985
79 Ga0466691_050892 3300042593 Bacteria 2452
80 Ga0466691_119461 3300042593 Bacteria 1875
81 Ga0466696_048632 3300042596 Bacteria 38305
82 Ga0466703_021792 3300042636 Bacteria 5037
83 JGI24695J34938_10003290 3300002450 Bacteria 11392
84 Ga0466732_075598 3300042656 Bacteria 4579
85 Ga0466712_032080 3300042614 Bacteria 3723
86 Ga0466715_143794 3300042616 Bacteria 10515
87 Ga0466718_070407 3300042617 Unclassified 2820
88 Ga0466723_030682 3300042618 Bacteria 4547
89 Ga0466716_340481 3300042605 Bacteria 1454
90 Ga0466722_186275 3300042609 Bacteria 9062
91 Ga0264413_102202 3300024493 Bacteria 9493
92 Ga0264413_103048 3300024493 Bacteria 11731
93 Ga0466731_063688 3300042622 Bacteria 2783
94 Ga0466708_128583 3300042652 Bacteria 2761
95 Ga0466727_154323 3300042655 Bacteria 9072
96 JGI24695J34938_10000566 3300002450 Bacteria 35687
97 Ga0466705_127139 3300042612 Bacteria 5161
98 Ga0466715_047259 3300042616 Bacteria 4142
99 Ga0123356_10106440 3300010049 Unclassified 2700
100 Ga0466713_144169 3300042602 Bacteria 27806
101 Ga0466722_120340 3300042609 Bacteria 1645
102 Ga0466690_019378 3300042590 Unclassified 2845
103 Ga0466694_066081 3300042594 Bacteria 14122
104 Ga0466696_292038 3300042596 Bacteria 5857
105 Ga0466696_345523 3300042596 Bacteria 48190
106 Ga0466708_082264 3300042652 Bacteria 6780
107 Ga0466708_208030 3300042652 Bacteria 7779
108 Ga0466727_204341 3300042655 Bacteria 1833
109 AustNasuHG_c1023932 3300000089 Bacteria 1942
110 JGI24698J34947_10015845 3300002449 Bacteria 4099
111 JGI24695J34938_10014721 3300002450 Bacteria 4040
112 Ga0466711_493263 3300042615 Bacteria 3382
113 Ga0466715_044898 3300042616 Bacteria 5977
114 Ga0466723_002413 3300042618 Bacteria 6979
115 Ga0466723_133351 3300042618 Bacteria 1392
116 Ga0466723_224197 3300042618 Bacteria 6785
117 Ga0466723_305864 3300042618 Bacteria 4310
118 Ga0123356_10532786 3300010049 Bacteria 1334
119 Ga0466722_057178 3300042609 Bacteria 17242
120 Ga0466692_041570 3300042591 Bacteria 10633
121 Ga0466692_131089 3300042591 Bacteria 3000
122 Ga0466694_251363 3300042594 Bacteria 4576
123 Ga0466696_198339 3300042596 Bacteria 5974
124 Ga0466702_160223 3300042635 Bacteria 16616
125 Ga0466703_147469 3300042636 Bacteria 10204
126 FAAS_10005886 3300001880 Bacteria 1136

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_340481 Ga0466716_340481_137_1123 311
2 3300002450 JGI24695J34938_10003290 JGI24695J34938_100032908 316
3 3300042609 Ga0466722_112156 Ga0466722_112156_162_1151 318
4 3300042615 Ga0466711_493263 Ga0466711_493263_168_1124 318
5 3300042624 Ga0466735_196552 Ga0466735_196552_19824_20780 318
6 3300042594 Ga0466694_367398 Ga0466694_367398_960_1922 320
7 3300042652 Ga0466708_389279 Ga0466708_389279_2679_3644 321
8 3300042618 Ga0466723_177039 Ga0466723_177039_1248_2240 324
9 3300042596 Ga0466696_345523 Ga0466696_345523_28812_29789 325
10 3300042614 Ga0466712_059979 Ga0466712_059979_2185_3162 325
11 3300042622 Ga0466731_421190 Ga0466731_421190_255_1232 325
12 3300038395 Ga0415639_046080 Ga0415639_046080_470_1453 327
13 3300042607 Ga0466720_011964 Ga0466720_011964_10063_11046 327
14 3300042656 Ga0466732_075598 Ga0466732_075598_526_1509 327
15 3300002449 JGI24698J34947_10015693 JGI24698J34947_100156931 328
16 3300002449 JGI24698J34947_10015845 JGI24698J34947_100158454 328
17 3300024493 Ga0264413_103048 Ga0264413_1030486 328
18 3300042591 Ga0466692_041570 Ga0466692_041570_5782_6768 328
19 3300042593 Ga0466691_045966 Ga0466691_045966_275_1261 328
20 3300042593 Ga0466691_119461 Ga0466691_119461_416_1402 328
21 3300042594 Ga0466694_053698 Ga0466694_053698_22929_23915 328
22 3300042594 Ga0466694_066081 Ga0466694_066081_12930_13916 328
23 3300042594 Ga0466694_154582 Ga0466694_154582_8008_8994 328
24 3300042594 Ga0466694_251363 Ga0466694_251363_294_1280 328
25 3300042595 Ga0466695_013771 Ga0466695_013771_123_1109 328
26 3300042596 Ga0466696_048632 Ga0466696_048632_18266_19252 328
27 3300042600 Ga0466700_153348 Ga0466700_153348_4809_5795 328
28 3300042602 Ga0466713_144169 Ga0466713_144169_26329_27315 328
29 3300042606 Ga0466719_340198 Ga0466719_340198_207_1193 328
30 3300042607 Ga0466720_068889 Ga0466720_068889_1456_2442 328
31 3300042612 Ga0466705_061756 Ga0466705_061756_505_1491 328
32 3300042612 Ga0466705_187537 Ga0466705_187537_545_1531 328
33 3300042616 Ga0466715_116575 Ga0466715_116575_1694_2680 328
34 3300042616 Ga0466715_441827 Ga0466715_441827_1882_2868 328
35 3300042617 Ga0466718_012956 Ga0466718_012956_1008_1994 328
36 3300042617 Ga0466718_070407 Ga0466718_070407_1384_2370 328
37 3300042617 Ga0466718_139367 Ga0466718_139367_313_1299 328
38 3300042617 Ga0466718_140799 Ga0466718_140799_1257_2243 328
39 3300042617 Ga0466718_153942 Ga0466718_153942_270_1256 328
40 3300042618 Ga0466723_133351 Ga0466723_133351_43_1029 328
41 3300042618 Ga0466723_224197 Ga0466723_224197_2916_3902 328
42 3300042622 Ga0466731_063688 Ga0466731_063688_1279_2265 328
43 3300042636 Ga0466703_147469 Ga0466703_147469_9152_10138 328
44 3300042648 Ga0466709_319989 Ga0466709_319989_1468_2454 328
45 3300042652 Ga0466708_064385 Ga0466708_064385_1460_2446 328
46 3300042655 Ga0466727_170492 Ga0466727_170492_1197_2183 328
47 iso_pr_bacteria 2781125644 2781295549 328
48 3300000089 AustNasuHG_c1023555 AustNasuHG_10235551 329
49 3300000089 AustNasuHG_c1023932 AustNasuHG_10239322 329
50 3300000089 AustNasuHG_c1040308 AustNasuHG_10403082 329
51 3300001880 FAAS_10005886 FAAS_100058862 329
52 3300002450 JGI24695J34938_10000178 JGI24695J34938_1000017813 329
53 3300002450 JGI24695J34938_10060300 JGI24695J34938_100603001 329
54 3300010049 Ga0123356_10004605 Ga0123356_1000460511 329
55 3300010049 Ga0123356_10567867 Ga0123356_105678671 329
56 3300024493 Ga0264413_102202 Ga0264413_1022022 329
57 3300041968 Ga0456237_0004104 Ga0456237_0004104_477_1466 329
58 3300042591 Ga0466692_044675 Ga0466692_044675_1757_2746 329
59 3300042607 Ga0466720_229384 Ga0466720_229384_2230_3219 329
60 3300042609 Ga0466722_057178 Ga0466722_057178_7641_8630 329
61 3300042609 Ga0466722_186275 Ga0466722_186275_3563_4552 329
62 3300042614 Ga0466712_032080 Ga0466712_032080_439_1428 329
63 3300042616 Ga0466715_084371 Ga0466715_084371_4946_5935 329
64 3300042618 Ga0466723_006055 Ga0466723_006055_13678_14667 329
65 3300042619 Ga0466726_132996 Ga0466726_132996_3384_4373 329
66 3300042643 Ga0466704_177650 Ga0466704_177650_14315_15304 329
67 3300042655 Ga0466727_204341 Ga0466727_204341_271_1260 329
68 3300042655 Ga0466727_344986 Ga0466727_344986_993_1982 329
69 3300038395 Ga0415639_226299 Ga0415639_226299_94_1086 330
70 3300042591 Ga0466692_096271 Ga0466692_096271_544_1581 330
71 3300042652 Ga0466708_128583 Ga0466708_128583_681_1673 330
72 3300042655 Ga0466727_154323 Ga0466727_154323_4014_5006 330
73 3300024493 Ga0264413_130951 Ga0264413_1309512 331
74 iso_pr_bacteria 2781125692 2781430769 331
75 3300042607 Ga0466720_096726 Ga0466720_096726_10359_11357 332
76 3300042625 Ga0466730_037164 Ga0466730_037164_49_1047 332
77 3300042652 Ga0466708_065662 Ga0466708_065662_1347_2345 332
78 iso_pr_bacteria 2781125663 2781338021 333
79 3300005201 Ga0072941_1108220 Ga0072941_11082202 334
80 3300010049 Ga0123356_10003713 Ga0123356_100037135 334
81 3300010049 Ga0123356_10106440 Ga0123356_101064401 334
82 3300002450 JGI24695J34938_10014721 JGI24695J34938_100147215 335
83 3300042609 Ga0466722_019023 Ga0466722_019023_7830_8837 335
84 3300010049 Ga0123356_10000080 Ga0123356_1000008033 336
85 3300010049 Ga0123356_10532786 Ga0123356_105327861 339
86 3300042616 Ga0466715_047259 Ga0466715_047259_205_1224 339
87 3300042616 Ga0466715_143794 Ga0466715_143794_4313_5332 339
88 3300042596 Ga0466696_292038 Ga0466696_292038_225_1247 340
89 3300042618 Ga0466723_305864 Ga0466723_305864_2348_3370 340
90 3300042620 Ga0466728_305002 Ga0466728_305002_2855_3877 340
91 3300042636 Ga0466703_021792 Ga0466703_021792_625_1647 340
92 3300042643 Ga0466704_063778 Ga0466704_063778_6543_7565 340
93 3300042648 Ga0466709_145786 Ga0466709_145786_1123_2145 340
94 3300002450 JGI24695J34938_10043357 JGI24695J34938_100433571 341
95 3300002449 JGI24698J34947_10014273 JGI24698J34947_100142734 342
96 3300042609 Ga0466722_053775 Ga0466722_053775_3122_4150 342
97 3300042618 Ga0466723_002413 Ga0466723_002413_416_1444 342
98 iso_pr_bacteria 2781125660 2781331903 342
99 3300002449 JGI24698J34947_10056871 JGI24698J34947_100568713 343
100 3300042652 Ga0466708_208030 Ga0466708_208030_4303_5334 343
101 3300042635 Ga0466702_194927 Ga0466702_194927_840_1889 344
102 iso_pr_bacteria 2781125648 2781305741 344
103 3300042616 Ga0466715_044898 Ga0466715_044898_1541_2578 345
104 3300042591 Ga0466692_131089 Ga0466692_131089_1559_2599 346
105 3300042612 Ga0466705_127139 Ga0466705_127139_2263_3306 347
106 3300042635 Ga0466702_160223 Ga0466702_160223_663_1712 349
107 3300002450 JGI24695J34938_10000566 JGI24695J34938_1000056621 351
108 3300002450 JGI24695J34938_10006663 JGI24695J34938_100066635 351
109 3300042652 Ga0466708_039890 Ga0466708_039890_3333_4388 351
110 3300042643 Ga0466704_325976 Ga0466704_325976_748_1806 352
111 3300042596 Ga0466696_015142 Ga0466696_015142_997_2067 356
112 3300042596 Ga0466696_133174 Ga0466696_133174_548_1621 357
113 3300042596 Ga0466696_198339 Ga0466696_198339_251_1324 357
114 3300042612 Ga0466705_390380 Ga0466705_390380_1222_2295 357
115 3300042636 Ga0466703_323924 Ga0466703_323924_1708_2781 357
116 3300042643 Ga0466704_589271 Ga0466704_589271_716_1789 357
117 3300010049 Ga0123356_10002217 Ga0123356_100022171 358
118 3300042590 Ga0466690_019378 Ga0466690_019378_1234_2310 358
119 3300042593 Ga0466691_050892 Ga0466691_050892_1136_2212 358
120 3300042593 Ga0466691_225487 Ga0466691_225487_269_1345 358
121 3300042618 Ga0466723_030682 Ga0466723_030682_1384_2460 358
122 3300042618 Ga0466723_102951 Ga0466723_102951_245_1321 358
123 3300042648 Ga0466709_021132 Ga0466709_021132_5206_6282 358
124 3300042652 Ga0466708_082264 Ga0466708_082264_1189_2265 358
125 3300042652 Ga0466708_090691 Ga0466708_090691_210_1286 358
126 3300042605 Ga0466716_169196 Ga0466716_169196_396_1475 359
127 3300042590 Ga0466690_396470 Ga0466690_396470_439_1521 360
128 3300042652 Ga0466708_138493 Ga0466708_138493_18_1100 360
129 3300042616 Ga0466715_555289 Ga0466715_555289_791_1876 361
130 3300042606 Ga0466719_130416 Ga0466719_130416_393_1490 365
131 3300042609 Ga0466722_120340 Ga0466722_120340_109_1266 385

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.