Protein Family IF06797

Metagenome Isolate
174 Members
58 Samples
163 Scaffolds
376.88 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_105067|Ga0466722_105067_1003_2376
Length
457 aa
Sequence
MRFYQATHPRGMQAGIGKQHPYRQRRRDAQIGRFYNDPSYEHSLWDIRKNDYFMRLPCLIAGEQAQVQKKSLHLPLKNQFISMSVSVKEITTRKDLQKFVRFNIDLYKGNPYHVPGLIDEEIMTLSKDKNPAFEVCEAVYFLAFKDGRIVGRIAGIINHRSNDTWKQKYVRFGFVDFIDDCEVVDALFAAVEGWAKEKGMSAVHGPLGFTDLDHEGMLVEGFDLQGTMATIYNHPYYPEHLARIGYVKDQDWREFRIYVPAEVPEKHLRIGEMVKQKYGLEVIKFKRRKEIWPYAYKIFDALNKAYAPLYGFTELTPAQIRYYVKMYIPMLRLDFITVVRRKSDDAVAGFGITMPNLTRALRKARGSLFPFGFVPLLKALYGRPKVVDLYLIGVLPEYRNKGVNALMFNDLIPRYNKLGVEYAESNPELETNNAVQSQWDYFRREHHKTRRVFIKHI

📊 Sample Types

Isolate 6.3%
Metagenome 93.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.9%
Kalotermitidae 24.1%
Blattidae 8.6%
Unclassified 8.6%
Rhinotermitidae 8.6%
Termopsidae 5.2%
Passalidae 3.4%
Hydrophilidae 3.4%

🌳 Taxonomy

Archaea 0
Bacteria 164
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
2 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
5 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
6 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
16 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
17 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
18 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
19 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
29 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
30 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
31 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
32 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
36 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
37 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
38 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
39 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
43 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
47 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
48 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
49 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
50 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
53 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
54 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
55 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
56 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
57 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
58 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_102098 3300042659 Bacteria 1948
2 Ga0466715_311355 3300042616 Bacteria 3091
3 Ga0466726_059499 3300042619 Bacteria 6756
4 Ga0466728_024965 3300042620 Bacteria 19772
5 Ga0466690_095901 3300042590 Bacteria 22451
6 Ga0466691_145457 3300042593 Bacteria 34874
7 Ga0466696_175253 3300042596 Bacteria 14796
8 Ga0466699_271742 3300042597 Bacteria 1527
9 Ga0466713_017018 3300042602 Bacteria 51598
10 Ga0466713_157157 3300042602 Bacteria 5985
11 Ga0466716_432386 3300042605 Bacteria 11024
12 Ga0466722_011222 3300042609 Bacteria 1536
13 Ga0466722_213117 3300042609 Bacteria 4037
14 2227463519 2225789004 Bacteria 25632
15 JGI24702J35022_10047481 3300002462 Bacteria 2285
16 JGI24702J35022_10065367 3300002462 Bacteria 1951
17 Ga0068302_10133969 3300005071 Bacteria 2921
18 Ga0466703_178920 3300042636 Unclassified 6461
19 Ga0466703_318079 3300042636 Bacteria 11727
20 Ga0466709_307822 3300042648 Bacteria 161839
21 Ga0466705_114303 3300042612 Bacteria 14740
22 Ga0466711_191356 3300042615 Bacteria 27508
23 Ga0466715_267820 3300042616 Unclassified 10097
24 Ga0466726_077127 3300042619 Bacteria 5352
25 Ga0466726_335343 3300042619 Bacteria 4819
26 Ga0466690_005427 3300042590 Bacteria 12975
27 Ga0123354_10028982 3300010882 Bacteria 8715
28 Ga0466713_062679 3300042602 Bacteria 24995
29 Ga0466719_016739 3300042606 Bacteria 6753
30 Ga0466722_023960 3300042609 Bacteria 61916
31 Ga0466722_175725 3300042609 Bacteria 3448
32 2227605181 2225789004 Unclassified 12278
33 JGI24702J35022_10000057 3300002462 Bacteria 46789
34 Ga0068302_10108545 3300005071 Bacteria 5634
35 Ga0072940_1080325 3300005200 Bacteria 2344
36 Ga0466703_280943 3300042636 Bacteria 23170
37 Ga0466704_285232 3300042643 Bacteria 17633
38 Ga0466709_279937 3300042648 Bacteria 21608
39 Ga0466724_27387 3300042649 Unclassified 6448
40 Ga0466711_288486 3300042615 Bacteria 9707
41 Ga0466711_431328 3300042615 Bacteria 2394
42 Ga0466715_177524 3300042616 Bacteria 29754
43 Ga0466715_384298 3300042616 Bacteria 5629
44 Ga0466715_580385 3300042616 Bacteria 13241
45 Ga0466723_055263 3300042618 Bacteria 32547
46 Ga0466728_348809 3300042620 Bacteria 15447
47 Ga0466656_307241 3300042550 Bacteria 34645
48 Ga0466693_069584 3300042592 Bacteria 1746
49 Ga0466691_128711 3300042593 Bacteria 13062
50 Ga0466696_079154 3300042596 Bacteria 7769
51 Ga0466696_195108 3300042596 Unclassified 1757
52 Ga0123356_10029871 3300010049 Bacteria 5101
53 Ga0466719_272152 3300042606 Bacteria 10174
54 Ga0068305_10107489 3300005083 Bacteria 6858
55 Ga0068305_10182290 3300005083 Bacteria 3364
56 Ga0123357_10003207 3300009784 Bacteria 18625
57 Ga0466704_517371 3300042643 Bacteria 8953
58 Ga0466708_349638 3300042652 Bacteria 47516
59 Ga0466725_165576 3300042654 Bacteria 35468
60 Ga0466727_049687 3300042655 Bacteria 8087
61 Ga0466727_073710 3300042655 Bacteria 9806
62 Ga0466705_110967 3300042612 Bacteria 24385
63 Ga0466710_163410 3300042613 Bacteria 13309
64 Ga0466711_060145 3300042615 Bacteria 25679
65 Ga0466715_292663 3300042616 Bacteria 8507
66 Ga0466715_618473 3300042616 Unclassified 2746
67 Ga0466723_138227 3300042618 Bacteria 6433
68 Ga0466726_332264 3300042619 Bacteria 8894
69 Ga0466690_269144 3300042590 Bacteria 16302
70 Ga0466696_123831 3300042596 Bacteria 10505
71 Ga0466696_315891 3300042596 Bacteria 4040
72 Ga0123357_10007980 3300009784 Bacteria 13168
73 Ga0466707_060912 3300042601 Bacteria 42028
74 Ga0466707_248901 3300042601 Bacteria 13572
75 Ga0466716_099453 3300042605 Bacteria 3635
76 Ga0466719_489521 3300042606 Bacteria 2347
77 Ga0466698_370210 3300042610 Bacteria 1293
78 IMNBL1DRAFT_c0020613 3300000062 Bacteria 2663
79 JGI24702J35022_10000963 3300002462 Bacteria 17969
80 JGI24702J35022_10001761 3300002462 Bacteria 13380
81 JGI24702J35022_10017308 3300002462 Bacteria 3939
82 Ga0068305_10020541 3300005083 Unclassified 10802
83 Ga0466704_221110 3300042643 Bacteria 40792
84 Ga0466704_355753 3300042643 Bacteria 30315
85 Ga0466704_533747 3300042643 Bacteria 5146
86 Ga0466709_411386 3300042648 Bacteria 55384
87 Ga0466708_435918 3300042652 Bacteria 11349
88 Ga0466727_031142 3300042655 Bacteria 12822
89 Ga0466705_035832 3300042612 Bacteria 29373
90 Ga0466732_363920 3300042656 Unclassified 1672
91 Ga0466712_128442 3300042614 Unclassified 1101
92 Ga0466711_050929 3300042615 Bacteria 3729
93 Ga0466657_347309 3300042582 Bacteria 1778
94 Ga0466692_063390 3300042591 Bacteria 95171
95 Ga0466692_097822 3300042591 Bacteria 1972
96 Ga0466692_110987 3300042591 Bacteria 14998
97 Ga0466691_044275 3300042593 Bacteria 2786
98 Ga0466696_164301 3300042596 Bacteria 10142
99 Ga0466713_060435 3300042602 Bacteria 2423
100 Ga0466713_139979 3300042602 Bacteria 2304
101 Ga0466716_420420 3300042605 Bacteria 4030
102 Ga0466719_562029 3300042606 Bacteria 1929
103 IMNBL1DRAFT_c0003735 3300000062 Bacteria 9544
104 Ga0466703_224650 3300042636 Bacteria 19913
105 Ga0466703_263656 3300042636 Bacteria 11570
106 Ga0466704_054717 3300042643 Bacteria 5661
107 Ga0466725_230878 3300042654 Bacteria 13850
108 Ga0466727_115764 3300042655 Bacteria 5655
109 Ga0466727_137933 3300042655 Bacteria 1505
110 Ga0466697_186132 3300042611 Bacteria 64133
111 Ga0466705_457608 3300042612 Bacteria 5629
112 Ga0466723_007065 3300042618 Bacteria 53793
113 Ga0466690_296178 3300042590 Bacteria 36079
114 Ga0466691_071250 3300042593 Bacteria 14524
115 Ga0466707_214392 3300042601 Bacteria 3488
116 Ga0466713_041697 3300042602 Bacteria 3518
117 Ga0466713_074435 3300042602 Bacteria 21266
118 Ga0466713_105532 3300042602 Bacteria 9537
119 Ga0466717_005462 3300042604 Bacteria 3740
120 Ga0466719_056990 3300042606 Bacteria 5650
121 Ga0466722_053445 3300042609 Bacteria 38463
122 Ga0466722_105067 3300042609 Bacteria 2573
123 2227247461 2225789004 Bacteria 31587
124 IMNBL1DRAFT_c0023804 3300000062 Bacteria 2391
125 JGI24699J35502_11134029 3300002509 Bacteria 25256
126 Ga0466703_279009 3300042636 Bacteria 7905
127 Ga0466704_261973 3300042643 Bacteria 8154
128 Ga0466704_576140 3300042643 Bacteria 20460
129 Ga0466709_265222 3300042648 Bacteria 14675
130 Ga0466705_109256 3300042612 Bacteria 32157
131 Ga0466710_260137 3300042613 Bacteria 3534
132 Ga0466711_211822 3300042615 Bacteria 5519
133 Ga0466723_089568 3300042618 Bacteria 54083
134 Ga0466729_014273 3300042621 Bacteria 6510
135 Ga0466690_167989 3300042590 Bacteria 19926
136 Ga0466692_005818 3300042591 Bacteria 74984
137 Ga0466691_205081 3300042593 Bacteria 7721
138 Ga0466696_079042 3300042596 Bacteria 7348
139 Ga0466707_026708 3300042601 Bacteria 11207
140 Ga0466707_204652 3300042601 Bacteria 1608
141 Ga0466713_031050 3300042602 Unclassified 2110
142 Ga0466716_049153 3300042605 Bacteria 20638
143 IMNBL1DRAFT_c0000112 3300000062 Bacteria 72967
144 Ga0466729_237192 3300042621 Bacteria 1466
145 Ga0466708_135081 3300042652 Bacteria 7486
146 Ga0466705_111638 3300042612 Bacteria 8328
147 Ga0466711_467682 3300042615 Bacteria 24337
148 Ga0466711_478258 3300042615 Bacteria 5361
149 Ga0466715_074491 3300042616 Bacteria 5487
150 Ga0466715_364671 3300042616 Bacteria 20378
151 Ga0466696_019948 3300042596 Bacteria 3800
152 Ga0466696_307764 3300042596 Bacteria 13458
153 Ga0123353_10304267 3300010167 Bacteria 2431
154 Ga0466700_227790 3300042600 Bacteria 3734
155 Ga0466707_246704 3300042601 Bacteria 5392
156 Ga0466713_038630 3300042602 Bacteria 81183
157 Ga0466717_019943 3300042604 Bacteria 1758
158 Ga0466719_019138 3300042606 Bacteria 17343
159 Ga0466722_010442 3300042609 Bacteria 16245
160 2227604902 2225789004 Bacteria 2305
161 JGI24705J35276_12238737 3300002504 Bacteria 48270
162 Ga0466704_124246 3300042643 Bacteria 3265
163 Ga0466704_224224 3300042643 Bacteria 2631

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_128442 Ga0466712_128442_98_1063 321
2 3300042596 Ga0466696_195108 Ga0466696_195108_205_1296 363
3 3300010167 Ga0123353_10304267 Ga0123353_103042672 367
4 3300042593 Ga0466691_145457 Ga0466691_145457_17326_18453 367
5 3300042612 Ga0466705_111638 Ga0466705_111638_2466_3593 367
6 3300042643 Ga0466704_054717 Ga0466704_054717_4541_5647 368
7 3300042596 Ga0466696_175253 Ga0466696_175253_11955_13082 370
8 2225789004 2227247461 2227689357 375
9 3300042550 Ga0466656_307241 Ga0466656_307241_4545_5672 375
10 3300042590 Ga0466690_005427 Ga0466690_005427_10350_11477 375
11 3300042590 Ga0466690_095901 Ga0466690_095901_10798_11925 375
12 3300042590 Ga0466690_167989 Ga0466690_167989_3820_4947 375
13 3300042590 Ga0466690_296178 Ga0466690_296178_21419_22546 375
14 3300042591 Ga0466692_005818 Ga0466692_005818_7366_8493 375
15 3300042591 Ga0466692_110987 Ga0466692_110987_596_1723 375
16 3300042592 Ga0466693_069584 Ga0466693_069584_53_1180 375
17 3300042593 Ga0466691_128711 Ga0466691_128711_11229_12356 375
18 3300042593 Ga0466691_205081 Ga0466691_205081_1246_2373 375
19 3300042596 Ga0466696_019948 Ga0466696_019948_82_1209 375
20 3300042596 Ga0466696_079154 Ga0466696_079154_2365_3492 375
21 3300042596 Ga0466696_123831 Ga0466696_123831_1407_2534 375
22 3300042596 Ga0466696_307764 Ga0466696_307764_395_1522 375
23 3300042596 Ga0466696_315891 Ga0466696_315891_2592_3719 375
24 3300042597 Ga0466699_271742 Ga0466699_271742_84_1211 375
25 3300042601 Ga0466707_026708 Ga0466707_026708_5708_6835 375
26 3300042601 Ga0466707_060912 Ga0466707_060912_28327_29454 375
27 3300042601 Ga0466707_204652 Ga0466707_204652_66_1193 375
28 3300042601 Ga0466707_246704 Ga0466707_246704_4026_5153 375
29 3300042602 Ga0466713_031050 Ga0466713_031050_581_1708 375
30 3300042602 Ga0466713_041697 Ga0466713_041697_1772_2899 375
31 3300042602 Ga0466713_060435 Ga0466713_060435_154_1281 375
32 3300042602 Ga0466713_062679 Ga0466713_062679_17522_18649 375
33 3300042602 Ga0466713_074435 Ga0466713_074435_8976_10103 375
34 3300042602 Ga0466713_105532 Ga0466713_105532_5943_7070 375
35 3300042604 Ga0466717_005462 Ga0466717_005462_418_1545 375
36 3300042604 Ga0466717_019943 Ga0466717_019943_501_1628 375
37 3300042605 Ga0466716_049153 Ga0466716_049153_18714_19841 375
38 3300042605 Ga0466716_099453 Ga0466716_099453_1038_2165 375
39 3300042605 Ga0466716_432386 Ga0466716_432386_4923_6050 375
40 3300042606 Ga0466719_016739 Ga0466719_016739_1093_2220 375
41 3300042606 Ga0466719_272152 Ga0466719_272152_6664_7791 375
42 3300042609 Ga0466722_011222 Ga0466722_011222_72_1199 375
43 3300042609 Ga0466722_023960 Ga0466722_023960_29147_30274 375
44 3300042609 Ga0466722_053445 Ga0466722_053445_11125_12252 375
45 3300042609 Ga0466722_213117 Ga0466722_213117_266_1393 375
46 3300042612 Ga0466705_035832 Ga0466705_035832_14564_15691 375
47 3300042612 Ga0466705_114303 Ga0466705_114303_8631_9758 375
48 3300042612 Ga0466705_457608 Ga0466705_457608_2946_4073 375
49 3300042613 Ga0466710_260137 Ga0466710_260137_1850_2977 375
50 3300042615 Ga0466711_060145 Ga0466711_060145_24117_25244 375
51 3300042615 Ga0466711_288486 Ga0466711_288486_4566_5693 375
52 3300042615 Ga0466711_431328 Ga0466711_431328_869_1996 375
53 3300042616 Ga0466715_074491 Ga0466715_074491_1963_3090 375
54 3300042616 Ga0466715_292663 Ga0466715_292663_5202_6329 375
55 3300042616 Ga0466715_311355 Ga0466715_311355_1627_2754 375
56 3300042616 Ga0466715_384298 Ga0466715_384298_2739_3866 375
57 3300042616 Ga0466715_618473 Ga0466715_618473_241_1368 375
58 3300042618 Ga0466723_007065 Ga0466723_007065_19073_20200 375
59 3300042618 Ga0466723_055263 Ga0466723_055263_14275_15402 375
60 3300042618 Ga0466723_138227 Ga0466723_138227_1637_2764 375
61 3300042619 Ga0466726_059499 Ga0466726_059499_1915_3042 375
62 3300042619 Ga0466726_077127 Ga0466726_077127_1194_2321 375
63 3300042619 Ga0466726_335343 Ga0466726_335343_1393_2520 375
64 3300042620 Ga0466728_348809 Ga0466728_348809_14040_15167 375
65 3300042636 Ga0466703_224650 Ga0466703_224650_10089_11216 375
66 3300042636 Ga0466703_279009 Ga0466703_279009_4309_5436 375
67 3300042636 Ga0466703_318079 Ga0466703_318079_10489_11616 375
68 3300042643 Ga0466704_221110 Ga0466704_221110_20708_21835 375
69 3300042643 Ga0466704_261973 Ga0466704_261973_4333_5460 375
70 3300042643 Ga0466704_285232 Ga0466704_285232_3652_4779 375
71 3300042643 Ga0466704_355753 Ga0466704_355753_9513_10640 375
72 3300042643 Ga0466704_517371 Ga0466704_517371_4484_5611 375
73 3300042643 Ga0466704_533747 Ga0466704_533747_1607_2734 375
74 3300042648 Ga0466709_265222 Ga0466709_265222_1113_2240 375
75 3300042648 Ga0466709_411386 Ga0466709_411386_7019_8146 375
76 3300042652 Ga0466708_135081 Ga0466708_135081_1051_2178 375
77 3300042652 Ga0466708_435918 Ga0466708_435918_2130_3257 375
78 3300042654 Ga0466725_165576 Ga0466725_165576_24113_25240 375
79 3300042654 Ga0466725_230878 Ga0466725_230878_6700_7827 375
80 3300042655 Ga0466727_049687 Ga0466727_049687_1942_3069 375
81 3300042655 Ga0466727_073710 Ga0466727_073710_4418_5545 375
82 3300042655 Ga0466727_115764 Ga0466727_115764_1681_2808 375
83 3300042655 Ga0466727_137933 Ga0466727_137933_368_1495 375
84 2225789004 2227463519 2227898789 376
85 2225789004 2227604902 2228173011 376
86 2225789004 2227605181 2228173613 376
87 3300000062 IMNBL1DRAFT_c0000112 IMNBL1DRAFT_00001129 376
88 3300000062 IMNBL1DRAFT_c0020613 IMNBL1DRAFT_00206132 376
89 3300002462 JGI24702J35022_10000057 JGI24702J35022_1000005715 376
90 3300002462 JGI24702J35022_10000963 JGI24702J35022_1000096311 376
91 3300002462 JGI24702J35022_10001761 JGI24702J35022_100017614 376
92 3300002462 JGI24702J35022_10017308 JGI24702J35022_100173083 376
93 3300002462 JGI24702J35022_10047481 JGI24702J35022_100474812 376
94 3300002462 JGI24702J35022_10065367 JGI24702J35022_100653671 376
95 3300002504 JGI24705J35276_12238737 JGI24705J35276_1223873737 376
96 3300005071 Ga0068302_10108545 Ga0068302_101085453 376
97 3300005071 Ga0068302_10133969 Ga0068302_101339693 376
98 3300005083 Ga0068305_10020541 Ga0068305_100205419 376
99 3300005083 Ga0068305_10107489 Ga0068305_101074896 376
100 3300005200 Ga0072940_1080325 Ga0072940_10803252 376
101 3300010049 Ga0123356_10029871 Ga0123356_100298715 376
102 3300042582 Ga0466657_347309 Ga0466657_347309_605_1735 376
103 3300042596 Ga0466696_079042 Ga0466696_079042_1072_2202 376
104 3300042596 Ga0466696_164301 Ga0466696_164301_7205_8335 376
105 3300042600 Ga0466700_227790 Ga0466700_227790_541_1671 376
106 3300042601 Ga0466707_248901 Ga0466707_248901_1632_2762 376
107 3300042602 Ga0466713_017018 Ga0466713_017018_40668_41798 376
108 3300042602 Ga0466713_139979 Ga0466713_139979_219_1349 376
109 3300042605 Ga0466716_420420 Ga0466716_420420_2126_3256 376
110 3300042606 Ga0466719_019138 Ga0466719_019138_14128_15258 376
111 3300042606 Ga0466719_056990 Ga0466719_056990_2672_3802 376
112 3300042606 Ga0466719_489521 Ga0466719_489521_425_1555 376
113 3300042606 Ga0466719_562029 Ga0466719_562029_280_1410 376
114 3300042611 Ga0466697_186132 Ga0466697_186132_16655_17785 376
115 3300042612 Ga0466705_110967 Ga0466705_110967_4024_5154 376
116 3300042615 Ga0466711_467682 Ga0466711_467682_21839_22969 376
117 3300042616 Ga0466715_364671 Ga0466715_364671_10560_11690 376
118 3300042618 Ga0466723_089568 Ga0466723_089568_45490_46620 376
119 3300042619 Ga0466726_332264 Ga0466726_332264_2181_3311 376
120 3300042621 Ga0466729_014273 Ga0466729_014273_3244_4374 376
121 3300042636 Ga0466703_280943 Ga0466703_280943_3969_5099 376
122 3300042643 Ga0466704_576140 Ga0466704_576140_11260_12390 376
123 3300042649 Ga0466724_27387 Ga0466724_27387_1015_2145 376
124 3300042652 Ga0466708_349638 Ga0466708_349638_9822_10952 376
125 3300042655 Ga0466727_031142 Ga0466727_031142_2254_3384 376
126 iso_pr_bacteria 2873600114 2873602941 376
127 iso_pr_bacteria 2873610414 2873613305 376
128 iso_pr_bacteria 2910930387 2910932979 376
129 iso_pr_bacteria 2940193328 2940194224 376
130 iso_pr_bacteria 2940336608 2940337416 376
131 3300000062 IMNBL1DRAFT_c0003735 IMNBL1DRAFT_00037354 377
132 3300009784 Ga0123357_10003207 Ga0123357_1000320713 377
133 3300009784 Ga0123357_10007980 Ga0123357_100079805 377
134 3300010882 Ga0123354_10028982 Ga0123354_100289827 377
135 3300042590 Ga0466690_269144 Ga0466690_269144_13170_14303 377
136 3300042593 Ga0466691_044275 Ga0466691_044275_1213_2346 377
137 3300042612 Ga0466705_109256 Ga0466705_109256_23810_24943 377
138 3300042615 Ga0466711_478258 Ga0466711_478258_3227_4360 377
139 3300042616 Ga0466715_177524 Ga0466715_177524_16350_17483 377
140 3300042620 Ga0466728_024965 Ga0466728_024965_10154_11287 377
141 3300042621 Ga0466729_237192 Ga0466729_237192_204_1337 377
142 3300042643 Ga0466704_124246 Ga0466704_124246_738_1871 377
143 3300042643 Ga0466704_224224 Ga0466704_224224_434_1567 377
144 iso_pr_bacteria 2910949487 2910950384 377
145 3300042591 Ga0466692_063390 Ga0466692_063390_5159_6295 378
146 3300042593 Ga0466691_071250 Ga0466691_071250_13019_14155 378
147 3300042610 Ga0466698_370210 Ga0466698_370210_11_1147 378
148 3300042613 Ga0466710_163410 Ga0466710_163410_11862_12998 378
149 iso_pr_bacteria 2940216256 2940217236 378
150 3300042602 Ga0466713_038630 Ga0466713_038630_56715_57854 379
151 3300042616 Ga0466715_267820 Ga0466715_267820_6906_8045 379
152 3300042636 Ga0466703_178920 Ga0466703_178920_269_1408 379
153 3300042636 Ga0466703_263656 Ga0466703_263656_4652_5791 379
154 3300042648 Ga0466709_307822 Ga0466709_307822_35147_36286 379
155 3300042656 Ga0466732_363920 Ga0466732_363920_122_1261 379
156 iso_pr_bacteria 8100166142 8100170264 379
157 3300005083 Ga0068305_10182290 Ga0068305_101822902 380
158 3300042602 Ga0466713_157157 Ga0466713_157157_4718_5860 380
159 3300042615 Ga0466711_050929 Ga0466711_050929_1863_3005 380
160 3300042616 Ga0466715_580385 Ga0466715_580385_1128_2270 380
161 3300042659 Ga0466733_102098 Ga0466733_102098_773_1915 380
162 iso_pr_bacteria 2820757377 2820758398 380
163 3300002509 JGI24699J35502_11134029 JGI24699J35502_1113402912 381
164 3300042601 Ga0466707_214392 Ga0466707_214392_743_1888 381
165 3300042591 Ga0466692_097822 Ga0466692_097822_624_1775 383
166 3300042609 Ga0466722_010442 Ga0466722_010442_9675_10826 383
167 3300042615 Ga0466711_211822 Ga0466711_211822_403_1557 384
168 3300042615 Ga0466711_191356 Ga0466711_191356_24593_25753 386
169 iso_pr_bacteria 2695420317 2695485239 391
170 iso_pr_bacteria 8100157865 8100158523 391
171 3300000062 IMNBL1DRAFT_c0023804 IMNBL1DRAFT_00238042 401
172 3300042609 Ga0466722_175725 Ga0466722_175725_918_2135 405
173 3300042648 Ga0466709_279937 Ga0466709_279937_17923_19239 438
174 3300042609 Ga0466722_105067 Ga0466722_105067_1003_2376 457

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.