Protein Family IF06791

Metagenome Isolate
168 Members
52 Samples
164 Scaffolds
238.31 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_096322|Ga0466722_096322_1286_2116
Length
276 aa
Sequence
LRFGSFSAISLVWQSQKKKLPNPCGNVSRNKGERMNRENGDALIVCQNAAFGYNGHNVVRGLSFAVLPGDYLCVVGENGSGKTTLVKGILGLLPPLEGSVSLAIRGKGTGYLSQESPSRKDFPAGVREVVLSGMAGRMGLRPFYSRREKEIAGENMRLLEIEDLQNRCFRELSGGQRRRVLIARSLCAGNTVLALDEPAAGLDPLVKAELYELLDTLNKETNIAVIMVTHDMEAAVKYANRILHVEKEQRFFGEIQEYLQSDTGKKFCTKGGRSND

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.0%
Kalotermitidae 28.0%
Unclassified 14.0%
Rhinotermitidae 6.0%
Passalidae 4.0%
Termopsidae 4.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 156
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
11 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
33 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
36 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
44 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
47 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
48 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_085244 3300042659 Bacteria 1685
2 Ga0466712_281458 3300042614 Unclassified 1226
3 Ga0466718_145144 3300042617 Bacteria 1623
4 Ga0466723_020169 3300042618 Bacteria 9249
5 Ga0466723_363123 3300042618 Bacteria 2593
6 Ga0123356_10255253 3300010049 Bacteria 1833
7 Ga0123353_10087884 3300010167 Bacteria 5006
8 Ga0123353_10254653 3300010167 Bacteria 2716
9 Ga0123353_10971041 3300010167 Bacteria 1146
10 Ga0415639_008623 3300038395 Bacteria 7357
11 Ga0466690_364560 3300042590 Bacteria 4940
12 Ga0466691_146040 3300042593 Bacteria 2453
13 Ga0466706_249691 3300042599 Bacteria 27960
14 Ga0466707_179812 3300042601 Bacteria 1999
15 Ga0466707_197673 3300042601 Bacteria 3203
16 Ga0466707_253404 3300042601 Bacteria 7682
17 Ga0466714_001119 3300042603 Bacteria 8517
18 Ga0466714_050867 3300042603 Bacteria 16193
19 Ga0466720_224443 3300042607 Bacteria 1902
20 Ga0466704_293202 3300042643 Bacteria 1429
21 Ga0466708_249081 3300042652 Bacteria 11493
22 Ga0466727_188796 3300042655 Bacteria 2191
23 Ga0466733_057345 3300042659 Bacteria 10681
24 2227591291 2225789004 Bacteria 12988
25 AustNasuHG_c1003188 3300000089 Bacteria 5921
26 JGI24698J34947_10028884 3300002449 Bacteria 2935
27 Ga0072941_1020172 3300005201 Unclassified 8601
28 Ga0466711_138824 3300042615 Bacteria 1307
29 Ga0466715_305337 3300042616 Bacteria 16941
30 Ga0123356_10524520 3300010049 Bacteria 1343
31 Ga0123356_10586345 3300010049 Bacteria 1279
32 Ga0123353_10247585 3300010167 Bacteria 2764
33 Ga0123353_10470671 3300010167 Bacteria 1842
34 Ga0264413_122033 3300024493 Bacteria 1714
35 Ga0415639_179721 3300038395 Bacteria 3309
36 Ga0466690_118787 3300042590 Bacteria 29579
37 Ga0466696_244005 3300042596 Bacteria 3130
38 Ga0466706_272041 3300042599 Bacteria 2971
39 Ga0466707_169729 3300042601 Bacteria 3786
40 Ga0466707_358647 3300042601 Bacteria 1954
41 Ga0466720_035220 3300042607 Bacteria 3655
42 Ga0466720_069356 3300042607 Bacteria 6117
43 Ga0466697_014089 3300042611 Bacteria 3435
44 Ga0466702_374051 3300042635 Bacteria 1140
45 Ga0466702_452276 3300042635 Bacteria 5765
46 Ga0466704_032398 3300042643 Bacteria 2435
47 Ga0466704_420295 3300042643 Bacteria 11425
48 Ga0466704_476763 3300042643 Bacteria 3292
49 Ga0466705_361357 3300042612 Bacteria 5131
50 Ga0466732_133291 3300042656 Bacteria 11346
51 Ga0466732_405976 3300042656 Bacteria 1196
52 Ga0466733_218509 3300042659 Bacteria 3121
53 IMNBL1DRAFT_c0000080 3300000062 Bacteria 86870
54 IMNBL1DRAFT_c0005120 3300000062 Unclassified 7624
55 AustNasuHG_c1000176 3300000089 Bacteria 20767
56 JGI24698J34947_10007288 3300002449 Bacteria 6076
57 Ga0466712_191243 3300042614 Bacteria 1689
58 Ga0466712_262943 3300042614 Bacteria 12636
59 Ga0466718_021391 3300042617 Bacteria 5183
60 Ga0123355_10001926 3300009826 Bacteria 29185
61 Ga0123353_10141404 3300010167 Bacteria 3855
62 Ga0415639_001400 3300038395 Bacteria 43729
63 Ga0466692_194825 3300042591 Bacteria 10966
64 Ga0466716_421466 3300042605 Bacteria 2047
65 Ga0466720_059350 3300042607 Bacteria 27311
66 Ga0466720_062545 3300042607 Bacteria 17805
67 Ga0466722_096322 3300042609 Bacteria 4609
68 Ga0466702_010676 3300042635 Bacteria 1403
69 Ga0466704_164054 3300042643 Bacteria 11506
70 Ga0466708_408392 3300042652 Bacteria 2150
71 Ga0466732_264684 3300042656 Unclassified 1194
72 AustNasuHG_c1039603 3300000089 Bacteria 1167
73 JGI24695J34938_10005171 3300002450 Bacteria 8251
74 Ga0072940_1045602 3300005200 Bacteria 17786
75 Ga0072941_1015913 3300005201 Bacteria 9255
76 Ga0466712_038134 3300042614 Unclassified 1763
77 Ga0466723_017317 3300042618 Bacteria 8109
78 Ga0466723_094468 3300042618 Bacteria 26470
79 Ga0466723_229121 3300042618 Bacteria 13114
80 Ga0466728_317256 3300042620 Bacteria 3094
81 Ga0264413_117405 3300024493 Bacteria 10725
82 Ga0415639_074638 3300038395 Bacteria 1857
83 Ga0466692_165820 3300042591 Bacteria 1298
84 Ga0466700_246197 3300042600 Bacteria 1573
85 Ga0466719_179696 3300042606 Bacteria 1879
86 Ga0466720_019572 3300042607 Bacteria 7555
87 Ga0466722_073618 3300042609 Bacteria 8648
88 Ga0466708_234738 3300042652 Bacteria 19411
89 Ga0074263_116550 3300005485 Unclassified 1918
90 Ga0466712_212758 3300042614 Unclassified 3125
91 Ga0466715_175093 3300042616 Unclassified 6214
92 Ga0466718_037534 3300042617 Bacteria 2026
93 Ga0466718_046748 3300042617 Bacteria 3309
94 Ga0466718_094080 3300042617 Bacteria 16654
95 Ga0466726_437032 3300042619 Bacteria 10714
96 Ga0123356_10210257 3300010049 Bacteria 1993
97 Ga0123353_10240578 3300010167 Bacteria 2813
98 Ga0123353_10282338 3300010167 Bacteria 2549
99 Ga0123353_10387000 3300010167 Bacteria 2089
100 Ga0123353_10900362 3300010167 Bacteria 1205
101 Ga0415639_246235 3300038395 Bacteria 1524
102 Ga0466706_010866 3300042599 Bacteria 6451
103 Ga0466713_096278 3300042602 Unclassified 10660
104 Ga0466716_340280 3300042605 Bacteria 11169
105 Ga0466719_288333 3300042606 Bacteria 1064
106 Ga0466709_108162 3300042648 Bacteria 2865
107 Ga0466732_069899 3300042656 Bacteria 3106
108 Ga0466732_273265 3300042656 Bacteria 18937
109 Ga0074263_115604 3300005485 Bacteria 2054
110 Ga0466715_148788 3300042616 Bacteria 5984
111 Ga0466715_350462 3300042616 Bacteria 102654
112 Ga0466726_099059 3300042619 Bacteria 23072
113 Ga0466726_266652 3300042619 Bacteria 6032
114 Ga0123353_10704885 3300010167 Bacteria 1416
115 Ga0123354_10332660 3300010882 Bacteria 1382
116 Ga0466691_226914 3300042593 Unclassified 2112
117 Ga0466694_314810 3300042594 Bacteria 2129
118 Ga0466713_150251 3300042602 Bacteria 5503
119 Ga0466720_069212 3300042607 Bacteria 9347
120 Ga0466722_084466 3300042609 Bacteria 18061
121 Ga0466703_234815 3300042636 Bacteria 52704
122 Ga0466704_067566 3300042643 Bacteria 2933
123 Ga0466727_335534 3300042655 Bacteria 3773
124 Ga0466705_154816 3300042612 Bacteria 2691
125 2227594084 2225789004 Bacteria 12733
126 JGI24698J34947_10082084 3300002449 Unclassified 1508
127 JGI24698J34947_10160798 3300002449 Bacteria 920
128 Ga0068305_10001165 3300005083 Bacteria 21562
129 Ga0466705_434025 3300042612 Bacteria 6853
130 Ga0466705_465860 3300042612 Bacteria 1498
131 Ga0466712_021212 3300042614 Bacteria 1530
132 Ga0466712_157047 3300042614 Unclassified 1863
133 Ga0466711_326065 3300042615 Bacteria 1229
134 Ga0466726_341367 3300042619 Bacteria 3185
135 Ga0123355_10527377 3300009826 Bacteria 1441
136 Ga0123356_10368094 3300010049 Bacteria 1566
137 Ga0123353_10424971 3300010167 Bacteria 1967
138 Ga0466696_241225 3300042596 Bacteria 1321
139 Ga0466699_413904 3300042597 Bacteria 18269
140 Ga0466720_019677 3300042607 Bacteria 6437
141 Ga0466720_054353 3300042607 Bacteria 3142
142 Ga0466720_087814 3300042607 Bacteria 7130
143 Ga0466722_232167 3300042609 Bacteria 1812
144 Ga0466703_304616 3300042636 Bacteria 21418
145 Ga0466704_091282 3300042643 Bacteria 1742
146 Ga0466704_491637 3300042643 Bacteria 1941
147 Ga0466709_075176 3300042648 Bacteria 20360
148 Ga0466709_330267 3300042648 Bacteria 16877
149 Ga0466708_014693 3300042652 Bacteria 14000
150 Ga0466727_067329 3300042655 Bacteria 27574
151 Ga0466705_069702 3300042612 Bacteria 37099
152 Ga0466705_084653 3300042612 Bacteria 3206
153 Ga0466726_406401 3300042619 Bacteria 4740
154 Ga0466729_124147 3300042621 Bacteria 3936
155 Ga0123355_10000574 3300009826 Bacteria 49477
156 Ga0123356_10011691 3300010049 Bacteria 8551
157 Ga0123356_10113163 3300010049 Bacteria 2625
158 Ga0123353_10515741 3300010167 Bacteria 1736
159 Ga0466692_055697 3300042591 Bacteria 29527
160 Ga0466722_140035 3300042609 Bacteria 3689
161 Ga0466702_240019 3300042635 Bacteria 1224
162 Ga0466703_142640 3300042636 Bacteria 7576
163 Ga0466704_134250 3300042643 Bacteria 3871
164 Ga0466709_115669 3300042648 Bacteria 217304

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_281458 Ga0466712_281458_607_1215 202
2 3300042593 Ga0466691_226914 Ga0466691_226914_1451_2071 206
3 3300042656 Ga0466732_264684 Ga0466732_264684_538_1179 213
4 3300042614 Ga0466712_157047 Ga0466712_157047_1102_1812 214
5 3300042614 Ga0466712_212758 Ga0466712_212758_1622_2332 214
6 3300002449 JGI24698J34947_10082084 JGI24698J34947_100820842 215
7 3300042614 Ga0466712_021212 Ga0466712_021212_538_1248 220
8 3300042619 Ga0466726_266652 Ga0466726_266652_3474_4205 221
9 3300038395 Ga0415639_001400 Ga0415639_001400_33497_34174 225
10 3300042602 Ga0466713_096278 Ga0466713_096278_5813_6490 225
11 3300042616 Ga0466715_350462 Ga0466715_350462_16049_16726 225
12 3300042648 Ga0466709_115669 Ga0466709_115669_93392_94069 225
13 3300010049 Ga0123356_10113163 Ga0123356_101131632 226
14 3300042635 Ga0466702_374051 Ga0466702_374051_201_917 226
15 3300009826 Ga0123355_10527377 Ga0123355_105273772 227
16 3300010167 Ga0123353_10900362 Ga0123353_109003622 227
17 3300042652 Ga0466708_234738 Ga0466708_234738_18330_19016 228
18 3300038395 Ga0415639_179721 Ga0415639_179721_1487_2179 230
19 3300042599 Ga0466706_249691 Ga0466706_249691_7977_8669 230
20 3300042599 Ga0466706_272041 Ga0466706_272041_2008_2700 230
21 3300042605 Ga0466716_421466 Ga0466716_421466_412_1104 230
22 3300042619 Ga0466726_341367 Ga0466726_341367_1684_2376 230
23 3300042656 Ga0466732_133291 Ga0466732_133291_8643_9335 230
24 3300024493 Ga0264413_117405 Ga0264413_1174059 231
25 3300042603 Ga0466714_001119 Ga0466714_001119_5989_6684 231
26 3300042607 Ga0466720_019572 Ga0466720_019572_3415_4110 231
27 3300042607 Ga0466720_019677 Ga0466720_019677_1338_2033 231
28 3300042607 Ga0466720_054353 Ga0466720_054353_731_1426 231
29 3300042607 Ga0466720_069356 Ga0466720_069356_2417_3112 231
30 3300000089 AustNasuHG_c1039603 AustNasuHG_10396032 232
31 3300005485 Ga0074263_115604 Ga0074263_1156042 232
32 3300005485 Ga0074263_116550 Ga0074263_1165503 232
33 3300010167 Ga0123353_10141404 Ga0123353_101414043 232
34 3300042619 Ga0466726_099059 Ga0466726_099059_19924_20622 232
35 3300042655 Ga0466727_067329 Ga0466727_067329_4158_4856 232
36 3300010049 Ga0123356_10524520 Ga0123356_105245201 233
37 3300042612 Ga0466705_465860 Ga0466705_465860_547_1248 233
38 3300038395 Ga0415639_074638 Ga0415639_074638_596_1300 234
39 3300042596 Ga0466696_244005 Ga0466696_244005_2154_2858 234
40 3300042600 Ga0466700_246197 Ga0466700_246197_151_855 234
41 3300042601 Ga0466707_253404 Ga0466707_253404_3065_3769 234
42 3300042602 Ga0466713_150251 Ga0466713_150251_1624_2328 234
43 3300042607 Ga0466720_087814 Ga0466720_087814_3601_4305 234
44 3300042614 Ga0466712_262943 Ga0466712_262943_908_1612 234
45 3300042636 Ga0466703_234815 Ga0466703_234815_29075_29779 234
46 3300042648 Ga0466709_108162 Ga0466709_108162_1795_2499 234
47 3300002449 JGI24698J34947_10028884 JGI24698J34947_100288842 235
48 3300005083 Ga0068305_10001165 Ga0068305_1000116512 235
49 3300038395 Ga0415639_246235 Ga0415639_246235_527_1234 235
50 3300042607 Ga0466720_224443 Ga0466720_224443_1120_1827 235
51 3300042609 Ga0466722_232167 Ga0466722_232167_620_1327 235
52 3300042611 Ga0466697_014089 Ga0466697_014089_2045_2752 235
53 3300042617 Ga0466718_021391 Ga0466718_021391_2104_2811 235
54 3300042617 Ga0466718_094080 Ga0466718_094080_15892_16599 235
55 3300042618 Ga0466723_363123 Ga0466723_363123_1782_2489 235
56 3300042656 Ga0466732_273265 Ga0466732_273265_13412_14119 235
57 3300042659 Ga0466733_218509 Ga0466733_218509_551_1258 235
58 2225789004 2227591291 2228150893 236
59 2225789004 2227594084 2228155644 236
60 3300010167 Ga0123353_10282338 Ga0123353_102823382 236
61 3300010167 Ga0123353_10387000 Ga0123353_103870003 236
62 3300010167 Ga0123353_10470671 Ga0123353_104706711 236
63 3300010167 Ga0123353_10971041 Ga0123353_109710411 236
64 3300042590 Ga0466690_118787 Ga0466690_118787_10256_10966 236
65 3300042594 Ga0466694_314810 Ga0466694_314810_999_1709 236
66 3300042596 Ga0466696_241225 Ga0466696_241225_32_742 236
67 3300042597 Ga0466699_413904 Ga0466699_413904_9081_9791 236
68 3300042601 Ga0466707_179812 Ga0466707_179812_573_1283 236
69 3300042601 Ga0466707_197673 Ga0466707_197673_284_994 236
70 3300042605 Ga0466716_340280 Ga0466716_340280_1932_2642 236
71 3300042607 Ga0466720_035220 Ga0466720_035220_1738_2448 236
72 3300042614 Ga0466712_038134 Ga0466712_038134_303_1013 236
73 3300042619 Ga0466726_437032 Ga0466726_437032_8189_8899 236
74 3300042655 Ga0466727_335534 Ga0466727_335534_1782_2492 236
75 3300042656 Ga0466732_405976 Ga0466732_405976_64_774 236
76 3300000062 IMNBL1DRAFT_c0000080 IMNBL1DRAFT_000008064 237
77 3300000062 IMNBL1DRAFT_c0005120 IMNBL1DRAFT_00051207 237
78 3300000089 AustNasuHG_c1000176 AustNasuHG_10001768 237
79 3300002449 JGI24698J34947_10160798 JGI24698J34947_101607981 237
80 3300002450 JGI24695J34938_10005171 JGI24695J34938_100051718 237
81 3300005200 Ga0072940_1045602 Ga0072940_10456027 237
82 3300005201 Ga0072941_1015913 Ga0072941_10159137 237
83 3300005201 Ga0072941_1020172 Ga0072941_10201728 237
84 3300038395 Ga0415639_008623 Ga0415639_008623_2680_3393 237
85 3300042601 Ga0466707_169729 Ga0466707_169729_2804_3517 237
86 3300042603 Ga0466714_050867 Ga0466714_050867_1405_2118 237
87 3300042606 Ga0466719_288333 Ga0466719_288333_267_980 237
88 3300042607 Ga0466720_059350 Ga0466720_059350_5992_6705 237
89 3300042620 Ga0466728_317256 Ga0466728_317256_1385_2098 237
90 3300042643 Ga0466704_164054 Ga0466704_164054_4555_5268 237
91 3300042659 Ga0466733_057345 Ga0466733_057345_9295_10008 237
92 iso_pr_bacteria 2820275298 2820276297 237
93 3300000089 AustNasuHG_c1003188 AustNasuHG_10031888 238
94 3300010049 Ga0123356_10368094 Ga0123356_103680942 238
95 3300010167 Ga0123353_10254653 Ga0123353_102546532 238
96 3300010167 Ga0123353_10515741 Ga0123353_105157411 238
97 3300024493 Ga0264413_122033 Ga0264413_1220332 238
98 3300042607 Ga0466720_062545 Ga0466720_062545_15832_16548 238
99 3300042607 Ga0466720_069212 Ga0466720_069212_5918_6634 238
100 3300042614 Ga0466712_191243 Ga0466712_191243_827_1543 238
101 3300002449 JGI24698J34947_10007288 JGI24698J34947_100072885 239
102 3300010167 Ga0123353_10247585 Ga0123353_102475852 239
103 3300010167 Ga0123353_10704885 Ga0123353_107048852 239
104 3300042599 Ga0466706_010866 Ga0466706_010866_5478_6197 239
105 3300042612 Ga0466705_084653 Ga0466705_084653_116_835 239
106 3300042612 Ga0466705_154816 Ga0466705_154816_1629_2348 239
107 3300042617 Ga0466718_145144 Ga0466718_145144_112_831 239
108 3300042635 Ga0466702_240019 Ga0466702_240019_348_1067 239
109 3300042643 Ga0466704_091282 Ga0466704_091282_461_1180 239
110 3300042643 Ga0466704_134250 Ga0466704_134250_956_1675 239
111 3300042643 Ga0466704_293202 Ga0466704_293202_107_826 239
112 3300042643 Ga0466704_420295 Ga0466704_420295_890_1609 239
113 3300042643 Ga0466704_476763 Ga0466704_476763_600_1319 239
114 3300042643 Ga0466704_491637 Ga0466704_491637_312_1031 239
115 iso_pr_bacteria 2820020240 2820021432 239
116 3300042591 Ga0466692_165820 Ga0466692_165820_535_1257 240
117 3300042635 Ga0466702_010676 Ga0466702_010676_529_1251 240
118 3300042635 Ga0466702_452276 Ga0466702_452276_1976_2698 240
119 3300009826 Ga0123355_10000574 Ga0123355_1000057435 241
120 3300010167 Ga0123353_10424971 Ga0123353_104249712 241
121 3300042615 Ga0466711_138824 Ga0466711_138824_251_976 241
122 3300042615 Ga0466711_326065 Ga0466711_326065_42_767 241
123 3300042619 Ga0466726_406401 Ga0466726_406401_730_1455 241
124 iso_pr_bacteria 2820447167 2820449263 241
125 3300009826 Ga0123355_10001926 Ga0123355_1000192611 242
126 3300010049 Ga0123356_10011691 Ga0123356_100116916 242
127 3300042609 Ga0466722_073618 Ga0466722_073618_486_1214 242
128 3300042656 Ga0466732_069899 Ga0466732_069899_969_1697 242
129 iso_pr_bacteria 2820353569 2820354684 242
130 3300042616 Ga0466715_148788 Ga0466715_148788_3061_3792 243
131 3300042591 Ga0466692_055697 Ga0466692_055697_28709_29443 244
132 3300042609 Ga0466722_140035 Ga0466722_140035_1603_2340 245
133 3300042612 Ga0466705_361357 Ga0466705_361357_3178_3915 245
134 3300042621 Ga0466729_124147 Ga0466729_124147_1398_2135 245
135 3300042636 Ga0466703_304616 Ga0466703_304616_17069_17806 245
136 3300042643 Ga0466704_032398 Ga0466704_032398_1234_1971 245
137 3300042648 Ga0466709_075176 Ga0466709_075176_5328_6065 245
138 3300010049 Ga0123356_10210257 Ga0123356_102102572 246
139 3300042590 Ga0466690_364560 Ga0466690_364560_2835_3575 246
140 3300042612 Ga0466705_434025 Ga0466705_434025_3552_4292 246
141 3300042618 Ga0466723_020169 Ga0466723_020169_1221_1961 246
142 3300042618 Ga0466723_229121 Ga0466723_229121_10042_10782 246
143 3300042643 Ga0466704_067566 Ga0466704_067566_1959_2699 246
144 3300042652 Ga0466708_408392 Ga0466708_408392_1400_2140 246
145 3300010049 Ga0123356_10586345 Ga0123356_105863451 247
146 3300010167 Ga0123353_10087884 Ga0123353_100878845 247
147 3300042618 Ga0466723_017317 Ga0466723_017317_35_778 247
148 3300042618 Ga0466723_094468 Ga0466723_094468_1766_2512 248
149 3300042612 Ga0466705_069702 Ga0466705_069702_28198_28947 249
150 3300042617 Ga0466718_046748 Ga0466718_046748_1815_2564 249
151 3300042652 Ga0466708_249081 Ga0466708_249081_5491_6240 249
152 3300042609 Ga0466722_084466 Ga0466722_084466_738_1490 250
153 3300042593 Ga0466691_146040 Ga0466691_146040_848_1603 251
154 3300042616 Ga0466715_175093 Ga0466715_175093_1970_2725 251
155 3300042591 Ga0466692_194825 Ga0466692_194825_6236_6994 252
156 3300042601 Ga0466707_358647 Ga0466707_358647_418_1176 252
157 3300042617 Ga0466718_037534 Ga0466718_037534_327_1088 253
158 3300042659 Ga0466733_085244 Ga0466733_085244_589_1350 253
159 3300010049 Ga0123356_10255253 Ga0123356_102552532 254
160 3300042606 Ga0466719_179696 Ga0466719_179696_766_1530 254
161 3300042636 Ga0466703_142640 Ga0466703_142640_2792_3625 256
162 3300042652 Ga0466708_014693 Ga0466708_014693_10525_11310 261
163 3300010167 Ga0123353_10240578 Ga0123353_102405782 266
164 3300010882 Ga0123354_10332660 Ga0123354_103326602 266
165 3300042616 Ga0466715_305337 Ga0466715_305337_9584_10384 266
166 3300042655 Ga0466727_188796 Ga0466727_188796_986_1822 270
167 3300042609 Ga0466722_096322 Ga0466722_096322_1286_2116 276
168 3300042648 Ga0466709_330267 Ga0466709_330267_14353_15237 294

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 60 199 0.9
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 134 233 0.75
PF02463 SMC_N RecF/RecN/SMC N terminal domain 73 246 0.71

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.