Protein Family IF06787

Metagenome Isolate
129 Members
50 Samples
120 Scaffolds
321.8 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_088374|Ga0466722_088374_9372_10487
Length
371 aa
Sequence
VSNPRTKRRGPVSNGGFVAKIAAFRYACGMDEPLFTAETAAAYLQPEYPDAALAAPASRAGEIRRLLERCLREHPVAADIRWNEPMAAHTTFHLGGPADCWVRPAGDGFPAFAAALLRDARAAAVPVFLLGGGANLLVADRGIRGIVLDTGAWAGSSQSGGCLVFRSGCSLDDAAETAAAAGLSGLEFLAGMPGSIGGAVWMNARCYGRDIAGSLCAVEIIDCAGGGEPLTLPVDRAAFGYKKSPFQNRNCLILSAAFNVTPGDTAAIRAEMESHRRDREAKGQYRFPSAGSAFKNNRAFGKPSGQIIDELGLRGLRLGGAQVAPFHGNILINAGGATAADIRALAAEVAARVQAAAGFSLEPEILFVGDW

📊 Sample Types

Isolate 7.0%
Metagenome 93.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.7%
Kalotermitidae 27.1%
Unclassified 18.8%
Termopsidae 6.2%
Rhinotermitidae 4.2%
Blaberidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
2 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
23 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2772190975 Treponema sp. RmG30 Isolate Blaberidae
31 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
32 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
33 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
34 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
35 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
40 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
41 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
42 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
46 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
47 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
48 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_125267 3300024493 Bacteria 3379
2 Ga0466699_082648 3300042597 Bacteria 5294
3 Ga0466718_102174 3300042617 Bacteria 3171
4 Ga0466701_079551 3300042598 Bacteria 2606
5 Ga0466716_399379 3300042605 Bacteria 4828
6 Ga0466719_167476 3300042606 Unclassified 5761
7 Ga0466719_374283 3300042606 Bacteria 4093
8 Ga0466722_035441 3300042609 Bacteria 26035
9 AustNasuHG_c1000031 3300000089 Bacteria 33623
10 AustNasuHG_c1006107 3300000089 Bacteria 4305
11 JGI24698J34947_10020250 3300002449 Unclassified 3585
12 Ga0068305_10300981 3300005083 Bacteria 6811
13 Ga0072940_1035794 3300005200 Unclassified 16352
14 Ga0072941_1022909 3300005201 Bacteria 6735
15 Ga0466735_187424 3300042624 Bacteria 5802
16 Ga0466702_106066 3300042635 Bacteria 27037
17 Ga0466708_374867 3300042652 Bacteria 12625
18 Ga0466727_109423 3300042655 Bacteria 5464
19 Ga0264413_130369 3300024493 Bacteria 1385
20 Ga0466699_165070 3300042597 Bacteria 2810
21 Ga0466699_296718 3300042597 Bacteria 3730
22 Ga0466715_101313 3300042616 Bacteria 28041
23 Ga0466718_149444 3300042617 Bacteria 1427
24 Ga0466723_160902 3300042618 Bacteria 23441
25 Ga0466723_197434 3300042618 Bacteria 2080
26 Ga0466720_025838 3300042607 Bacteria 8963
27 JGI24698J34947_10014282 3300002449 Bacteria 4325
28 JGI24698J34947_10033091 3300002449 Bacteria 2713
29 JGI24695J34938_10000569 3300002450 Bacteria 35542
30 JGI24695J34938_10025715 3300002450 Bacteria 2809
31 Ga0466704_379437 3300042643 Bacteria 3508
32 Ga0466691_036935 3300042593 Bacteria 16681
33 Ga0466699_013230 3300042597 Bacteria 1808
34 Ga0466722_025586 3300042609 Bacteria 42977
35 Ga0466722_031805 3300042609 Bacteria 4681
36 Ga0466722_167734 3300042609 Bacteria 3146
37 Ga0123356_10002539 3300010049 Bacteria 19514
38 JGI24700J35501_10930442 3300002508 Bacteria 14143
39 Ga0466702_013657 3300042635 Bacteria 3491
40 Ga0466708_190732 3300042652 Bacteria 13771
41 Ga0264413_134599 3300024493 Bacteria 1388
42 Ga0466692_079331 3300042591 Bacteria 4195
43 Ga0466696_078017 3300042596 Bacteria 1915
44 Ga0466711_129135 3300042615 Bacteria 31830
45 Ga0466718_046323 3300042617 Bacteria 4055
46 Ga0466723_297357 3300042618 Bacteria 12476
47 Ga0466719_061034 3300042606 Bacteria 12552
48 Ga0466722_038833 3300042609 Bacteria 3002
49 Ga0466722_160110 3300042609 Bacteria 27287
50 Ga0466698_026835 3300042610 Bacteria 11996
51 Ga0123356_10206371 3300010049 Bacteria 2009
52 JGI24695J34938_10001326 3300002450 Bacteria 21394
53 JGI24695J34938_10004281 3300002450 Bacteria 9434
54 JGI24695J34938_10033833 3300002450 Bacteria 2348
55 Ga0466690_171936 3300042590 Bacteria 20676
56 Ga0466691_081910 3300042593 Bacteria 24279
57 Ga0466694_232941 3300042594 Bacteria 22254
58 Ga0466696_035320 3300042596 Bacteria 28404
59 Ga0466699_043739 3300042597 Bacteria 2199
60 Ga0466705_471305 3300042612 Bacteria 12959
61 Ga0466711_377664 3300042615 Bacteria 5748
62 Ga0466723_122398 3300042618 Bacteria 3449
63 Ga0466726_463952 3300042619 Bacteria 2188
64 Ga0466717_136678 3300042604 Bacteria 1725
65 Ga0123355_10013606 3300009826 Bacteria 12674
66 Ga0123356_10001169 3300010049 Bacteria 29033
67 JGI24698J34947_10001409 3300002449 Bacteria 12672
68 JGI24695J34938_10042688 3300002450 Bacteria 2027
69 JGI24695J34938_10043893 3300002450 Bacteria 1991
70 JGI24702J35022_10011907 3300002462 Bacteria 4843
71 Ga0072941_1157662 3300005201 Bacteria 2905
72 Ga0466704_249234 3300042643 Bacteria 26787
73 Ga0466690_023955 3300042590 Bacteria 2509
74 Ga0466690_207550 3300042590 Bacteria 1576
75 Ga0466690_399347 3300042590 Bacteria 23386
76 Ga0466692_039538 3300042591 Bacteria 3488
77 Ga0466696_066684 3300042596 Bacteria 2671
78 Ga0466699_115629 3300042597 Bacteria 1254
79 Ga0466699_228709 3300042597 Bacteria 2250
80 Ga0466712_039038 3300042614 Bacteria 39310
81 Ga0466712_105906 3300042614 Bacteria 18258
82 Ga0466712_257911 3300042614 Bacteria 2591
83 Ga0466723_048331 3300042618 Bacteria 25354
84 Ga0466728_154650 3300042620 Bacteria 24366
85 Ga0466716_055527 3300042605 Bacteria 6009
86 JGI24695J34938_10000019 3300002450 Bacteria 113818
87 Ga0072941_1087344 3300005201 Bacteria 4002
88 Ga0466712_286738 3300042614 Bacteria 8688
89 Ga0466715_450397 3300042616 Bacteria 24675
90 Ga0466718_007431 3300042617 Bacteria 4265
91 Ga0466723_185870 3300042618 Bacteria 38207
92 Ga0466719_104615 3300042606 Bacteria 13046
93 Ga0123353_10253682 3300010167 Bacteria 2722
94 Ga0123354_10089274 3300010882 Bacteria 4279
95 JGI24698J34947_10002387 3300002449 Bacteria 10114
96 JGI24698J34947_10029025 3300002449 Bacteria 2926
97 JGI24702J35022_10009081 3300002462 Bacteria 5600
98 Ga0074263_112082 3300005485 Bacteria 4629
99 Ga0466703_008115 3300042636 Bacteria 67821
100 Ga0264413_100787 3300024493 Bacteria 17408
101 Ga0466690_398145 3300042590 Bacteria 33429
102 Ga0466692_166756 3300042591 Bacteria 8860
103 Ga0466694_288612 3300042594 Bacteria 28574
104 Ga0466696_057018 3300042596 Bacteria 47522
105 Ga0466712_007985 3300042614 Bacteria 81055
106 Ga0466711_005340 3300042615 Bacteria 15312
107 Ga0466726_194857 3300042619 Bacteria 3595
108 Ga0466726_391843 3300042619 Bacteria 10306
109 Ga0466720_064828 3300042607 Bacteria 13311
110 Ga0466722_088374 3300042609 Bacteria 12760
111 Ga0466698_180002 3300042610 Bacteria 2373
112 Ga0123356_10003238 3300010049 Bacteria 17109
113 JGI24698J34947_10002408 3300002449 Bacteria 10065
114 JGI24698J34947_10006791 3300002449 Bacteria 6288
115 JGI24695J34938_10000101 3300002450 Bacteria 74732
116 JGI24695J34938_10015438 3300002450 Bacteria 3920
117 Ga0466702_069960 3300042635 Bacteria 24936
118 Ga0466703_301713 3300042636 Bacteria 18332
119 Ga0466704_113486 3300042643 Bacteria 1624
120 Ga0466704_595538 3300042643 Bacteria 11734

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_055527 Ga0466716_055527_80_871 263
2 3300042609 Ga0466722_160110 Ga0466722_160110_8898_9848 299
3 3300042652 Ga0466708_190732 Ga0466708_190732_334_1305 302
4 3300000089 AustNasuHG_c1006107 AustNasuHG_10061072 305
5 3300042597 Ga0466699_043739 Ga0466699_043739_903_1859 306
6 3300042591 Ga0466692_166756 Ga0466692_166756_7903_8850 308
7 3300005201 Ga0072941_1087344 Ga0072941_10873443 309
8 3300042615 Ga0466711_005340 Ga0466711_005340_8157_9140 309
9 3300042594 Ga0466694_232941 Ga0466694_232941_15319_16254 311
10 3300042594 Ga0466694_288612 Ga0466694_288612_11226_12161 311
11 3300042606 Ga0466719_167476 Ga0466719_167476_154_1089 311
12 3300042635 Ga0466702_069960 Ga0466702_069960_14721_15656 311
13 3300042636 Ga0466703_301713 Ga0466703_301713_13981_14916 311
14 iso_pr_bacteria 2772190975 2773723863 311
15 3300042597 Ga0466699_115629 Ga0466699_115629_296_1234 312
16 3300042597 Ga0466699_165070 Ga0466699_165070_1796_2734 312
17 3300042615 Ga0466711_377664 Ga0466711_377664_4664_5602 312
18 3300042606 Ga0466719_061034 Ga0466719_061034_5944_6885 313
19 3300042617 Ga0466718_046323 Ga0466718_046323_3048_3989 313
20 3300042617 Ga0466718_149444 Ga0466718_149444_399_1340 313
21 3300042619 Ga0466726_391843 Ga0466726_391843_9112_10053 313
22 3300005083 Ga0068305_10300981 Ga0068305_103009814 314
23 3300042610 Ga0466698_180002 Ga0466698_180002_566_1564 314
24 3300024493 Ga0264413_100787 Ga0264413_1007875 315
25 3300042597 Ga0466699_296718 Ga0466699_296718_963_1910 315
26 3300042609 Ga0466722_167734 Ga0466722_167734_1638_2609 315
27 3300042614 Ga0466712_039038 Ga0466712_039038_13973_14920 315
28 3300042614 Ga0466712_105906 Ga0466712_105906_12924_13922 315
29 3300042618 Ga0466723_297357 Ga0466723_297357_9163_10110 315
30 3300042619 Ga0466726_463952 Ga0466726_463952_1078_2025 315
31 3300002449 JGI24698J34947_10020250 JGI24698J34947_100202504 316
32 3300042597 Ga0466699_013230 Ga0466699_013230_490_1440 316
33 3300042620 Ga0466728_154650 Ga0466728_154650_16732_17682 316
34 3300042635 Ga0466702_013657 Ga0466702_013657_1201_2151 316
35 3300002449 JGI24698J34947_10001409 JGI24698J34947_100014098 317
36 3300042596 Ga0466696_035320 Ga0466696_035320_11666_12619 317
37 3300042604 Ga0466717_136678 Ga0466717_136678_457_1410 317
38 3300042615 Ga0466711_129135 Ga0466711_129135_29597_30550 317
39 3300042643 Ga0466704_113486 Ga0466704_113486_452_1405 317
40 3300042643 Ga0466704_379437 Ga0466704_379437_452_1405 317
41 3300002450 JGI24695J34938_10004281 JGI24695J34938_100042815 318
42 3300002450 JGI24695J34938_10015438 JGI24695J34938_100154381 318
43 3300010049 Ga0123356_10206371 Ga0123356_102063711 318
44 3300042591 Ga0466692_039538 Ga0466692_039538_1096_2052 318
45 3300042605 Ga0466716_399379 Ga0466716_399379_2476_3432 318
46 3300042609 Ga0466722_035441 Ga0466722_035441_736_1692 318
47 3300042610 Ga0466698_026835 Ga0466698_026835_8375_9331 318
48 3300042614 Ga0466712_257911 Ga0466712_257911_1573_2529 318
49 3300042617 Ga0466718_007431 Ga0466718_007431_2240_3196 318
50 3300042652 Ga0466708_374867 Ga0466708_374867_9884_10840 318
51 iso_pr_bacteria 2781125663 2781337608 318
52 3300000089 AustNasuHG_c1000031 AustNasuHG_100003121 319
53 3300002449 JGI24698J34947_10002408 JGI24698J34947_100024088 319
54 3300002450 JGI24695J34938_10033833 JGI24695J34938_100338332 319
55 3300005200 Ga0072940_1035794 Ga0072940_10357945 319
56 3300010049 Ga0123356_10001169 Ga0123356_1000116922 319
57 3300024493 Ga0264413_130369 Ga0264413_1303691 319
58 3300042591 Ga0466692_079331 Ga0466692_079331_665_1624 319
59 3300042607 Ga0466720_025838 Ga0466720_025838_7392_8351 319
60 iso_pr_bacteria 2781125696 2781441014 319
61 iso_pr_bacteria 2819994798 2819996698 319
62 3300002462 JGI24702J35022_10011907 JGI24702J35022_100119072 320
63 3300002508 JGI24700J35501_10930442 JGI24700J35501_109304428 320
64 3300042635 Ga0466702_106066 Ga0466702_106066_4215_5177 320
65 3300042590 Ga0466690_399347 Ga0466690_399347_13312_14277 321
66 3300042598 Ga0466701_079551 Ga0466701_079551_1499_2488 321
67 3300042618 Ga0466723_048331 Ga0466723_048331_9130_10095 321
68 3300042618 Ga0466723_160902 Ga0466723_160902_17228_18220 321
69 iso_pr_bacteria 2781125636 2781279390 321
70 iso_pr_bacteria 2781125646 2781300378 321
71 3300002449 JGI24698J34947_10006791 JGI24698J34947_100067915 322
72 3300002449 JGI24698J34947_10014282 JGI24698J34947_100142822 322
73 3300002450 JGI24695J34938_10000019 JGI24695J34938_1000001976 322
74 3300005201 Ga0072941_1022909 Ga0072941_10229093 322
75 3300005201 Ga0072941_1157662 Ga0072941_11576622 322
76 3300042596 Ga0466696_066684 Ga0466696_066684_1647_2615 322
77 3300042607 Ga0466720_064828 Ga0466720_064828_1311_2279 322
78 3300042624 Ga0466735_187424 Ga0466735_187424_3792_4760 322
79 3300010049 Ga0123356_10003238 Ga0123356_100032388 323
80 3300042590 Ga0466690_023955 Ga0466690_023955_1231_2202 323
81 3300042597 Ga0466699_228709 Ga0466699_228709_333_1304 323
82 3300042619 Ga0466726_194857 Ga0466726_194857_2019_2990 323
83 3300042643 Ga0466704_595538 Ga0466704_595538_7299_8270 323
84 3300002450 JGI24695J34938_10000101 JGI24695J34938_100001017 324
85 3300024493 Ga0264413_125267 Ga0264413_1252672 325
86 3300024493 Ga0264413_134599 Ga0264413_1345992 325
87 3300042590 Ga0466690_207550 Ga0466690_207550_281_1258 325
88 3300005485 Ga0074263_112082 Ga0074263_1120822 326
89 3300010049 Ga0123356_10002539 Ga0123356_1000253913 327
90 3300042609 Ga0466722_038833 Ga0466722_038833_1599_2582 327
91 iso_pr_bacteria 2781125647 2781303034 327
92 3300002449 JGI24698J34947_10033091 JGI24698J34947_100330912 328
93 3300002450 JGI24695J34938_10000569 JGI24695J34938_100005693 328
94 3300010167 Ga0123353_10253682 Ga0123353_102536822 328
95 3300042590 Ga0466690_171936 Ga0466690_171936_9743_10729 328
96 3300042596 Ga0466696_057018 Ga0466696_057018_6989_7975 328
97 3300042614 Ga0466712_286738 Ga0466712_286738_4640_5626 328
98 3300042618 Ga0466723_197434 Ga0466723_197434_306_1292 328
99 iso_pr_bacteria 2781125656 2781320291 328
100 3300009826 Ga0123355_10013606 Ga0123355_1001360611 329
101 3300042596 Ga0466696_078017 Ga0466696_078017_498_1487 329
102 3300042609 Ga0466722_031805 Ga0466722_031805_2003_3028 329
103 3300042618 Ga0466723_122398 Ga0466723_122398_859_1848 329
104 3300042593 Ga0466691_081910 Ga0466691_081910_20466_21458 330
105 3300042616 Ga0466715_101313 Ga0466715_101313_17688_18680 330
106 3300042636 Ga0466703_008115 Ga0466703_008115_21674_22666 330
107 3300002450 JGI24695J34938_10025715 JGI24695J34938_100257152 331
108 3300002450 JGI24695J34938_10042688 JGI24695J34938_100426882 331
109 3300002450 JGI24695J34938_10043893 JGI24695J34938_100438932 331
110 3300042616 Ga0466715_450397 Ga0466715_450397_15810_16805 331
111 3300002449 JGI24698J34947_10002387 JGI24698J34947_100023877 333
112 3300002449 JGI24698J34947_10029025 JGI24698J34947_100290251 333
113 3300042597 Ga0466699_082648 Ga0466699_082648_4047_5048 333
114 3300042614 Ga0466712_007985 Ga0466712_007985_71670_72671 333
115 3300042606 Ga0466719_104615 Ga0466719_104615_4095_5099 334
116 3300042612 Ga0466705_471305 Ga0466705_471305_11823_12827 334
117 3300042643 Ga0466704_249234 Ga0466704_249234_24123_25127 334
118 3300002450 JGI24695J34938_10001326 JGI24695J34938_1000132613 335
119 3300002462 JGI24702J35022_10009081 JGI24702J35022_100090816 335
120 3300042609 Ga0466722_025586 Ga0466722_025586_32854_33861 335
121 iso_pr_bacteria 2781125687 2781421079 335
122 3300010882 Ga0123354_10089274 Ga0123354_100892743 336
123 3300042593 Ga0466691_036935 Ga0466691_036935_13926_14945 339
124 3300042617 Ga0466718_102174 Ga0466718_102174_2113_3138 341
125 3300042590 Ga0466690_398145 Ga0466690_398145_3913_4941 342
126 3300042606 Ga0466719_374283 Ga0466719_374283_2621_3688 342
127 3300042655 Ga0466727_109423 Ga0466727_109423_827_1855 342
128 3300042618 Ga0466723_185870 Ga0466723_185870_10084_11124 346
129 3300042609 Ga0466722_088374 Ga0466722_088374_9372_10487 371

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 268 368 0.97
PF01565 FAD_binding_4 FAD binding domain 114 222 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02873 GO:0008762 UDP-N-acetylmuramate dehydrogenase activity MF
PF01565 GO:0050660 flavin adenine dinucleotide binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.