Protein Family IF06781

Metagenome Isolate
193 Members
52 Samples
187 Scaffolds
165.09 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_083098|Ga0466722_083098_169_753
Length
194 aa
Sequence
VAAKIHNLNRLLWFFNPHFPKVYHTGDKENRMPENEYRRPSWDEYFMEVCDAIAKRATCDRGRSGCVIAKDNQLLVTGYVGAPAGLPHCDEVGHQFKQMLHEDGSVTTHCVRTVHAEQNAICQAAKRGIPISGATLYCRMTPCRTCAMLIINCGIVRVVCQRRYHDGGDSEAMFAKAGITLEYVHDEVQQYEKQ

πŸ“Š Sample Types

Isolate 3.1%
Metagenome 96.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 40.0%
Kalotermitidae 28.0%
Unclassified 16.0%
Rhinotermitidae 8.0%
Termopsidae 6.0%
Passalidae 2.0%

🌳 Taxonomy

Archaea 3
Bacteria 170
Eukaryota 0
Viruses 0
Unclassified 20

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
20 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
21 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
22 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
23 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
29 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
30 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
31 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
32 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
37 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
38 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
41 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
47 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
48 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
49 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
50 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
51 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
52 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_11811501 3300010049 Archaea 759
2 Ga0123353_10914217 3300010167 Unclassified 1193
3 Ga0466712_022070 3300042614 Bacteria 1324
4 Ga0466712_042197 3300042614 Bacteria 13711
5 Ga0466711_167283 3300042615 Bacteria 2672
6 Ga0466715_169524 3300042616 Bacteria 17527
7 Ga0466726_330184 3300042619 Bacteria 6856
8 Ga0466707_203556 3300042601 Bacteria 1947
9 Ga0466720_026808 3300042607 Bacteria 11297
10 Ga0466720_202653 3300042607 Bacteria 24999
11 Ga0466722_004820 3300042609 Bacteria 1452
12 Ga0466722_083098 3300042609 Bacteria 8261
13 Ga0466722_156117 3300042609 Bacteria 4351
14 Ga0466722_253615 3300042609 Bacteria 3901
15 Ga0466699_059640 3300042597 Bacteria 47744
16 Ga0466699_221331 3300042597 Bacteria 8319
17 Ga0466731_099359 3300042622 Bacteria 4462
18 Ga0466704_042739 3300042643 Bacteria 2611
19 Ga0466727_215907 3300042655 Bacteria 1440
20 Ga0123356_11110676 3300010049 Bacteria 959
21 Ga0466732_006561 3300042656 Bacteria 4233
22 Ga0466732_222355 3300042656 Bacteria 1560
23 JGI24698J34947_10024096 3300002449 Bacteria 3251
24 JGI24695J34938_10007039 3300002450 Bacteria 6657
25 Ga0466712_277462 3300042614 Bacteria 1233
26 Ga0466728_039789 3300042620 Bacteria 2151
27 Ga0466700_037696 3300042600 Bacteria 1239
28 Ga0466707_324814 3300042601 Bacteria 1118
29 Ga0466720_083817 3300042607 Bacteria 14286
30 Ga0466722_165194 3300042609 Bacteria 4666
31 Ga0466722_239362 3300042609 Bacteria 27768
32 Ga0466698_249615 3300042610 Bacteria 1080
33 Ga0456237_0000064 3300041968 Bacteria 14969
34 Ga0466692_100514 3300042591 Bacteria 8345
35 Ga0466691_082659 3300042593 Bacteria 3771
36 Ga0466696_017564 3300042596 Bacteria 33026
37 Ga0466699_365611 3300042597 Bacteria 7639
38 Ga0466705_103001 3300042612 Unclassified 4360
39 Ga0466729_234972 3300042621 Unclassified 1199
40 Ga0466709_284196 3300042648 Bacteria 18825
41 Ga0123353_10103331 3300010167 Bacteria 4593
42 Ga0123353_10440501 3300010167 Bacteria 1922
43 Ga0123353_10534079 3300010167 Bacteria 1697
44 Ga0123353_11285607 3300010167 Unclassified 951
45 Ga0123354_10436084 3300010882 Bacteria 1074
46 Ga0466732_268328 3300042656 Bacteria 1753
47 JGI24698J34947_10132956 3300002449 Bacteria 1060
48 Ga0072940_1109438 3300005200 Bacteria 799
49 Ga0466718_016493 3300042617 Bacteria 2009
50 Ga0466718_020186 3300042617 Bacteria 16920
51 Ga0466723_109320 3300042618 Bacteria 10178
52 Ga0466700_115112 3300042600 Archaea 1383
53 Ga0466700_277318 3300042600 Bacteria 1001
54 Ga0466722_238629 3300042609 Bacteria 12982
55 Ga0466722_239790 3300042609 Unclassified 2052
56 Ga0466698_394443 3300042610 Bacteria 1069
57 Ga0466698_486317 3300042610 Bacteria 2180
58 Ga0466690_121299 3300042590 Unclassified 3539
59 Ga0466692_070133 3300042591 Bacteria 1002
60 Ga0466691_016993 3300042593 Bacteria 7784
61 Ga0466691_054711 3300042593 Bacteria 1896
62 Ga0466705_328583 3300042612 Bacteria 7781
63 Ga0466731_339199 3300042622 Bacteria 43843
64 Ga0466735_203429 3300042624 Bacteria 1192
65 Ga0466703_077197 3300042636 Bacteria 16924
66 Ga0466704_265126 3300042643 Unclassified 1989
67 Ga0123354_10678108 3300010882 Bacteria 727
68 Ga0466732_164966 3300042656 Bacteria 8192
69 JGI24698J34947_10026068 3300002449 Unclassified 3109
70 JGI24698J34947_10058259 3300002449 Bacteria 1914
71 JGI24698J34947_10081406 3300002449 Bacteria 1518
72 Ga0068305_10050686 3300005083 Bacteria 2987
73 Ga0072941_1044035 3300005201 Bacteria 4760
74 Ga0466712_037815 3300042614 Unclassified 10024
75 Ga0466712_049609 3300042614 Bacteria 3196
76 Ga0466712_066790 3300042614 Bacteria 31024
77 Ga0466712_199670 3300042614 Unclassified 2192
78 Ga0466712_221090 3300042614 Bacteria 8046
79 Ga0466711_338036 3300042615 Bacteria 2189
80 Ga0466711_442880 3300042615 Unclassified 2195
81 Ga0466726_335318 3300042619 Bacteria 1228
82 Ga0466726_497104 3300042619 Bacteria 2579
83 Ga0466720_100776 3300042607 Bacteria 35029
84 Ga0466720_150429 3300042607 Unclassified 9062
85 Ga0456237_0007483 3300041968 Bacteria 1679
86 Ga0456237_0019477 3300041968 Bacteria 944
87 Ga0466690_098801 3300042590 Bacteria 8571
88 Ga0466692_077714 3300042591 Bacteria 2820
89 Ga0466692_092196 3300042591 Bacteria 1507
90 Ga0466696_418181 3300042596 Bacteria 6301
91 Ga0466727_182399 3300042655 Bacteria 1331
92 Ga0123357_10652434 3300009784 Bacteria 778
93 Ga0123353_10641196 3300010167 Bacteria 1506
94 Ga0123354_10360357 3300010882 Bacteria 1283
95 AustNasuHG_c1023032 3300000089 Unclassified 1994
96 JGI24698J34947_10004600 3300002449 Bacteria 7518
97 JGI24695J34938_10054045 3300002450 Bacteria 1743
98 Ga0466712_041274 3300042614 Bacteria 5081
99 Ga0466712_111132 3300042614 Bacteria 1129
100 Ga0466712_186337 3300042614 Unclassified 11346
101 Ga0466711_023601 3300042615 Unclassified 5747
102 Ga0466718_016393 3300042617 Bacteria 23217
103 Ga0466726_221588 3300042619 Bacteria 2399
104 Ga0466726_341516 3300042619 Bacteria 1510
105 Ga0466700_184053 3300042600 Bacteria 1767
106 Ga0466707_000664 3300042601 Bacteria 1325
107 Ga0466692_203632 3300042591 Bacteria 17371
108 Ga0466699_018132 3300042597 Bacteria 1534
109 Ga0466699_423996 3300042597 Bacteria 15119
110 Ga0466708_406541 3300042652 Bacteria 2090
111 Ga0123353_11481086 3300010167 Bacteria 866
112 Ga0123354_10128938 3300010882 Unclassified 3209
113 JGI24698J34947_10020173 3300002449 Bacteria 3594
114 JGI24702J35022_10002938 3300002462 Bacteria 10312
115 Ga0068305_10000903 3300005083 Bacteria 10167
116 Ga0466712_052059 3300042614 Bacteria 79687
117 Ga0466712_156968 3300042614 Bacteria 2123
118 Ga0466723_259470 3300042618 Bacteria 15035
119 Ga0466716_146455 3300042605 Bacteria 21520
120 Ga0466719_142623 3300042606 Bacteria 7941
121 Ga0466720_081012 3300042607 Bacteria 5344
122 Ga0466720_141815 3300042607 Bacteria 13412
123 Ga0466720_147532 3300042607 Bacteria 19881
124 Ga0415639_165780 3300038395 Bacteria 1332
125 Ga0466690_141462 3300042590 Bacteria 1489
126 Ga0466696_016014 3300042596 Bacteria 6118
127 Ga0466696_151342 3300042596 Bacteria 10046
128 Ga0466705_063692 3300042612 Bacteria 1309
129 Ga0466703_142193 3300042636 Bacteria 17251
130 Ga0466708_125344 3300042652 Bacteria 26258
131 Ga0466727_148665 3300042655 Bacteria 1294
132 Ga0466727_219094 3300042655 Bacteria 10010
133 Ga0123357_10303706 3300009784 Bacteria 1607
134 Ga0123357_10357952 3300009784 Bacteria 1386
135 Ga0123357_10599863 3300009784 Bacteria 846
136 Ga0123356_12877002 3300010049 Bacteria 602
137 Ga0123353_10338241 3300010167 Bacteria 2275
138 Ga0123353_10354288 3300010167 Archaea 2209
139 Ga0123353_10607415 3300010167 Bacteria 1561
140 Ga0123353_11046190 3300010167 Bacteria 1091
141 Ga0123353_12262593 3300010167 Bacteria 655
142 2227129975 2225789004 Bacteria 1665
143 JGI24698J34947_10001919 3300002449 Bacteria 11075
144 JGI24698J34947_10008308 3300002449 Bacteria 5692
145 JGI24698J34947_10010628 3300002449 Bacteria 5052
146 JGI24698J34947_10038553 3300002449 Unclassified 2478
147 JGI24698J34947_10061609 3300002449 Bacteria 1845
148 JGI24702J35022_10016609 3300002462 Bacteria 4032
149 Ga0068305_10018320 3300005083 Bacteria 7909
150 Ga0466712_087749 3300042614 Bacteria 43183
151 Ga0466712_089437 3300042614 Unclassified 11316
152 Ga0466711_011675 3300042615 Bacteria 3857
153 Ga0466715_042867 3300042616 Bacteria 2599
154 Ga0466718_062922 3300042617 Bacteria 20441
155 Ga0466716_130660 3300042605 Bacteria 4419
156 Ga0466719_170837 3300042606 Bacteria 3651
157 Ga0466719_359578 3300042606 Bacteria 9005
158 Ga0466722_086687 3300042609 Bacteria 5876
159 Ga0466692_022972 3300042591 Bacteria 5600
160 Ga0466691_133776 3300042593 Bacteria 5748
161 Ga0466694_007564 3300042594 Bacteria 6517
162 Ga0466694_230170 3300042594 Bacteria 1161
163 Ga0466699_440570 3300042597 Bacteria 19120
164 Ga0466735_033991 3300042624 Bacteria 16705
165 Ga0466735_167944 3300042624 Bacteria 8234
166 Ga0466704_264522 3300042643 Bacteria 19667
167 Ga0466704_460367 3300042643 Bacteria 6733
168 Ga0466708_023711 3300042652 Bacteria 8023
169 Ga0466708_165474 3300042652 Bacteria 34114
170 Ga0466708_275739 3300042652 Bacteria 2948
171 Ga0466727_072749 3300042655 Bacteria 5645
172 Ga0123357_10377451 3300009784 Bacteria 1320
173 Ga0123355_10299906 3300009826 Bacteria 2192
174 Ga0123356_10584141 3300010049 Bacteria 1281
175 Ga0123353_10817789 3300010167 Bacteria 1283
176 AustNasuHG_c1025723 3300000089 Bacteria 1845
177 Ga0466712_278440 3300042614 Bacteria 1310
178 Ga0466718_046928 3300042617 Bacteria 4344
179 Ga0466723_031125 3300042618 Bacteria 2936
180 Ga0466720_041045 3300042607 Bacteria 14375
181 Ga0264413_130652 3300024493 Bacteria 5547
182 Ga0466692_042303 3300042591 Bacteria 7582
183 Ga0466694_029990 3300042594 Bacteria 16898
184 Ga0466694_190579 3300042594 Bacteria 1229
185 Ga0466696_386203 3300042596 Unclassified 1236
186 Ga0466704_340969 3300042643 Unclassified 1888
187 Ga0466704_506123 3300042643 Bacteria 10442

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_253615 Ga0466722_253615_2622_3098 158
2 3300042622 Ga0466731_339199 Ga0466731_339199_14971_15447 158
3 3300042624 Ga0466735_203429 Ga0466735_203429_634_1110 158
4 3300042612 Ga0466705_328583 Ga0466705_328583_2563_3042 159
5 3300042643 Ga0466704_265126 Ga0466704_265126_1015_1494 159
6 3300042643 Ga0466704_340969 Ga0466704_340969_1015_1494 159
7 3300042593 Ga0466691_082659 Ga0466691_082659_1060_1542 160
8 3300042600 Ga0466700_115112 Ga0466700_115112_848_1330 160
9 3300042612 Ga0466705_063692 Ga0466705_063692_497_979 160
10 3300042643 Ga0466704_264522 Ga0466704_264522_12358_12840 160
11 3300010049 Ga0123356_11811501 Ga0123356_118115011 161
12 3300038395 Ga0415639_165780 Ga0415639_165780_691_1176 161
13 3300041968 Ga0456237_0000064 Ga0456237_0000064_2637_3122 161
14 3300042590 Ga0466690_121299 Ga0466690_121299_449_934 161
15 3300042590 Ga0466690_141462 Ga0466690_141462_449_934 161
16 3300042596 Ga0466696_418181 Ga0466696_418181_226_711 161
17 3300042605 Ga0466716_146455 Ga0466716_146455_5277_5762 161
18 3300042615 Ga0466711_338036 Ga0466711_338036_304_789 161
19 3300042619 Ga0466726_221588 Ga0466726_221588_160_645 161
20 3300042619 Ga0466726_335318 Ga0466726_335318_730_1215 161
21 3300042619 Ga0466726_497104 Ga0466726_497104_1884_2369 161
22 3300042620 Ga0466728_039789 Ga0466728_039789_1570_2055 161
23 3300042622 Ga0466731_099359 Ga0466731_099359_3537_4022 161
24 3300042624 Ga0466735_167944 Ga0466735_167944_386_871 161
25 3300042652 Ga0466708_125344 Ga0466708_125344_155_640 161
26 3300042655 Ga0466727_072749 Ga0466727_072749_4032_4517 161
27 3300042655 Ga0466727_148665 Ga0466727_148665_658_1143 161
28 iso_pr_bacteria 2781125690 2781427774 161
29 3300005083 Ga0068305_10050686 Ga0068305_100506862 162
30 3300010049 Ga0123356_11110676 Ga0123356_111106761 162
31 3300010167 Ga0123353_11481086 Ga0123353_114810861 162
32 3300041968 Ga0456237_0007483 Ga0456237_0007483_84_572 162
33 3300042596 Ga0466696_017564 Ga0466696_017564_7124_7612 162
34 3300042596 Ga0466696_151342 Ga0466696_151342_2725_3213 162
35 3300042600 Ga0466700_184053 Ga0466700_184053_58_546 162
36 3300042624 Ga0466735_033991 Ga0466735_033991_15496_15984 162
37 3300042652 Ga0466708_023711 Ga0466708_023711_3275_3763 162
38 3300042655 Ga0466727_182399 Ga0466727_182399_264_752 162
39 3300042655 Ga0466727_219094 Ga0466727_219094_606_1094 162
40 3300024493 Ga0264413_130652 Ga0264413_1306525 163
41 3300041968 Ga0456237_0019477 Ga0456237_0019477_395_886 163
42 3300042591 Ga0466692_022972 Ga0466692_022972_1875_2366 163
43 3300042591 Ga0466692_042303 Ga0466692_042303_2003_2494 163
44 3300042591 Ga0466692_070133 Ga0466692_070133_293_784 163
45 3300042591 Ga0466692_100514 Ga0466692_100514_2065_2556 163
46 3300042594 Ga0466694_007564 Ga0466694_007564_2188_2679 163
47 3300042594 Ga0466694_029990 Ga0466694_029990_249_740 163
48 3300042594 Ga0466694_190579 Ga0466694_190579_622_1113 163
49 3300042596 Ga0466696_016014 Ga0466696_016014_404_895 163
50 3300042597 Ga0466699_018132 Ga0466699_018132_980_1471 163
51 3300042597 Ga0466699_059640 Ga0466699_059640_19697_20188 163
52 3300042597 Ga0466699_221331 Ga0466699_221331_3287_3778 163
53 3300042597 Ga0466699_365611 Ga0466699_365611_5826_6317 163
54 3300042597 Ga0466699_423996 Ga0466699_423996_7796_8287 163
55 3300042597 Ga0466699_440570 Ga0466699_440570_10276_10767 163
56 3300042600 Ga0466700_037696 Ga0466700_037696_212_703 163
57 3300042600 Ga0466700_277318 Ga0466700_277318_376_867 163
58 3300042601 Ga0466707_000664 Ga0466707_000664_717_1208 163
59 3300042601 Ga0466707_203556 Ga0466707_203556_895_1386 163
60 3300042605 Ga0466716_130660 Ga0466716_130660_3010_3501 163
61 3300042607 Ga0466720_026808 Ga0466720_026808_6256_6747 163
62 3300042607 Ga0466720_041045 Ga0466720_041045_11355_11846 163
63 3300042607 Ga0466720_083817 Ga0466720_083817_1454_1945 163
64 3300042607 Ga0466720_100776 Ga0466720_100776_18542_19033 163
65 3300042607 Ga0466720_141815 Ga0466720_141815_2416_2907 163
66 3300042607 Ga0466720_147532 Ga0466720_147532_18315_18806 163
67 3300042607 Ga0466720_150429 Ga0466720_150429_991_1482 163
68 3300042607 Ga0466720_202653 Ga0466720_202653_149_640 163
69 3300042609 Ga0466722_004820 Ga0466722_004820_517_1008 163
70 3300042609 Ga0466722_086687 Ga0466722_086687_4484_4975 163
71 3300042609 Ga0466722_156117 Ga0466722_156117_301_792 163
72 3300042609 Ga0466722_165194 Ga0466722_165194_2223_2714 163
73 3300042609 Ga0466722_238629 Ga0466722_238629_5786_6277 163
74 3300042609 Ga0466722_239790 Ga0466722_239790_41_532 163
75 3300042610 Ga0466698_249615 Ga0466698_249615_360_851 163
76 3300042610 Ga0466698_394443 Ga0466698_394443_53_544 163
77 3300042610 Ga0466698_486317 Ga0466698_486317_1659_2150 163
78 3300042614 Ga0466712_022070 Ga0466712_022070_549_1040 163
79 3300042614 Ga0466712_037815 Ga0466712_037815_2922_3413 163
80 3300042614 Ga0466712_041274 Ga0466712_041274_3909_4400 163
81 3300042614 Ga0466712_042197 Ga0466712_042197_12361_12852 163
82 3300042614 Ga0466712_049609 Ga0466712_049609_1953_2444 163
83 3300042614 Ga0466712_052059 Ga0466712_052059_76706_77197 163
84 3300042614 Ga0466712_089437 Ga0466712_089437_1799_2290 163
85 3300042614 Ga0466712_111132 Ga0466712_111132_318_809 163
86 3300042614 Ga0466712_156968 Ga0466712_156968_313_804 163
87 3300042614 Ga0466712_186337 Ga0466712_186337_3120_3611 163
88 3300042614 Ga0466712_199670 Ga0466712_199670_610_1101 163
89 3300042614 Ga0466712_221090 Ga0466712_221090_5824_6315 163
90 3300042614 Ga0466712_277462 Ga0466712_277462_166_657 163
91 3300042614 Ga0466712_278440 Ga0466712_278440_213_704 163
92 3300042615 Ga0466711_011675 Ga0466711_011675_1064_1555 163
93 3300042615 Ga0466711_023601 Ga0466711_023601_3396_3887 163
94 3300042615 Ga0466711_167283 Ga0466711_167283_205_696 163
95 3300042615 Ga0466711_442880 Ga0466711_442880_51_542 163
96 3300042616 Ga0466715_042867 Ga0466715_042867_154_645 163
97 3300042616 Ga0466715_169524 Ga0466715_169524_15259_15750 163
98 3300042617 Ga0466718_016393 Ga0466718_016393_11480_11971 163
99 3300042617 Ga0466718_046928 Ga0466718_046928_1574_2065 163
100 3300042619 Ga0466726_341516 Ga0466726_341516_863_1354 163
101 3300042621 Ga0466729_234972 Ga0466729_234972_561_1052 163
102 3300042648 Ga0466709_284196 Ga0466709_284196_7257_7748 163
103 3300042652 Ga0466708_165474 Ga0466708_165474_15207_15698 163
104 3300042652 Ga0466708_406541 Ga0466708_406541_1533_2024 163
105 3300042655 Ga0466727_215907 Ga0466727_215907_890_1381 163
106 3300042656 Ga0466732_006561 Ga0466732_006561_1555_2046 163
107 3300042656 Ga0466732_164966 Ga0466732_164966_27_518 163
108 iso_pr_bacteria 2781125651 2781310052 163
109 iso_pr_bacteria 2781125658 2781326663 163
110 iso_pr_bacteria 2781125696 2781441397 163
111 3300000089 AustNasuHG_c1023032 AustNasuHG_10230323 164
112 3300000089 AustNasuHG_c1025723 AustNasuHG_10257232 164
113 3300002449 JGI24698J34947_10001919 JGI24698J34947_100019197 164
114 3300002449 JGI24698J34947_10004600 JGI24698J34947_100046002 164
115 3300002449 JGI24698J34947_10008308 JGI24698J34947_100083085 164
116 3300002449 JGI24698J34947_10020173 JGI24698J34947_100201733 164
117 3300002449 JGI24698J34947_10024096 JGI24698J34947_100240963 164
118 3300002449 JGI24698J34947_10026068 JGI24698J34947_100260683 164
119 3300002449 JGI24698J34947_10038553 JGI24698J34947_100385533 164
120 3300002449 JGI24698J34947_10058259 JGI24698J34947_100582592 164
121 3300002449 JGI24698J34947_10081406 JGI24698J34947_100814062 164
122 3300002449 JGI24698J34947_10132956 JGI24698J34947_101329562 164
123 3300002450 JGI24695J34938_10007039 JGI24695J34938_100070396 164
124 3300002450 JGI24695J34938_10054045 JGI24695J34938_100540452 164
125 3300002462 JGI24702J35022_10002938 JGI24702J35022_100029382 164
126 3300005201 Ga0072941_1044035 Ga0072941_10440356 164
127 3300009784 Ga0123357_10357952 Ga0123357_103579522 164
128 3300009784 Ga0123357_10377451 Ga0123357_103774512 164
129 3300009784 Ga0123357_10599863 Ga0123357_105998631 164
130 3300010049 Ga0123356_10584141 Ga0123356_105841411 164
131 3300010049 Ga0123356_12877002 Ga0123356_128770021 164
132 3300010167 Ga0123353_10354288 Ga0123353_103542883 164
133 3300010167 Ga0123353_10440501 Ga0123353_104405012 164
134 3300010167 Ga0123353_10534079 Ga0123353_105340792 164
135 3300010167 Ga0123353_10607415 Ga0123353_106074152 164
136 3300010167 Ga0123353_10641196 Ga0123353_106411962 164
137 3300010167 Ga0123353_10817789 Ga0123353_108177892 164
138 3300010167 Ga0123353_10914217 Ga0123353_109142171 164
139 3300010167 Ga0123353_11285607 Ga0123353_112856071 164
140 3300010882 Ga0123354_10360357 Ga0123354_103603572 164
141 3300010882 Ga0123354_10436084 Ga0123354_104360842 164
142 3300042596 Ga0466696_386203 Ga0466696_386203_563_1057 164
143 3300042614 Ga0466712_066790 Ga0466712_066790_2532_3026 164
144 3300042614 Ga0466712_087749 Ga0466712_087749_2647_3141 164
145 3300042617 Ga0466718_020186 Ga0466718_020186_13270_13764 164
146 3300042656 Ga0466732_268328 Ga0466732_268328_623_1117 164
147 3300002449 JGI24698J34947_10061609 JGI24698J34947_100616092 165
148 3300005200 Ga0072940_1109438 Ga0072940_11094382 165
149 3300009784 Ga0123357_10303706 Ga0123357_103037062 165
150 3300042601 Ga0466707_324814 Ga0466707_324814_123_620 165
151 3300042606 Ga0466719_142623 Ga0466719_142623_4020_4517 165
152 3300042606 Ga0466719_359578 Ga0466719_359578_6554_7051 165
153 iso_pr_bacteria 2781125682 2781408785 165
154 3300042590 Ga0466690_098801 Ga0466690_098801_5975_6475 166
155 3300042594 Ga0466694_230170 Ga0466694_230170_533_1033 166
156 3300042617 Ga0466718_062922 Ga0466718_062922_9213_9713 166
157 3300042618 Ga0466723_259470 Ga0466723_259470_163_663 166
158 3300042619 Ga0466726_330184 Ga0466726_330184_18_518 166
159 iso_pr_bacteria 2781125688 2781424390 166
160 3300010167 Ga0123353_11046190 Ga0123353_110461901 167
161 3300010882 Ga0123354_10128938 Ga0123354_101289382 167
162 3300042591 Ga0466692_077714 Ga0466692_077714_1895_2398 167
163 3300042606 Ga0466719_170837 Ga0466719_170837_736_1239 167
164 3300042612 Ga0466705_103001 Ga0466705_103001_530_1033 167
165 3300042643 Ga0466704_042739 Ga0466704_042739_1025_1528 167
166 3300042643 Ga0466704_506123 Ga0466704_506123_1706_2209 167
167 3300009784 Ga0123357_10652434 Ga0123357_106524341 168
168 3300010167 Ga0123353_10103331 Ga0123353_101033312 168
169 3300042593 Ga0466691_133776 Ga0466691_133776_2657_3163 168
170 3300009826 Ga0123355_10299906 Ga0123355_102999062 169
171 3300042609 Ga0466722_239362 Ga0466722_239362_6334_6843 169
172 3300042617 Ga0466718_016493 Ga0466718_016493_326_835 169
173 3300042636 Ga0466703_142193 Ga0466703_142193_1444_1956 170
174 3300042656 Ga0466732_222355 Ga0466732_222355_130_642 170
175 3300010167 Ga0123353_12262593 Ga0123353_122625931 171
176 3300010882 Ga0123354_10678108 Ga0123354_106781081 171
177 3300042593 Ga0466691_016993 Ga0466691_016993_7003_7518 171
178 3300042618 Ga0466723_031125 Ga0466723_031125_1782_2297 171
179 3300042618 Ga0466723_109320 Ga0466723_109320_6488_7003 171
180 2225789004 2227129975 2227526584 173
181 3300002462 JGI24702J35022_10016609 JGI24702J35022_100166091 173
182 3300010167 Ga0123353_10338241 Ga0123353_103382412 173
183 3300042652 Ga0466708_275739 Ga0466708_275739_2298_2822 174
184 3300042591 Ga0466692_092196 Ga0466692_092196_56_583 175
185 3300005083 Ga0068305_10000903 Ga0068305_1000090311 179
186 3300042591 Ga0466692_203632 Ga0466692_203632_6601_7146 181
187 3300042607 Ga0466720_081012 Ga0466720_081012_189_734 181
188 3300002449 JGI24698J34947_10010628 JGI24698J34947_100106282 182
189 3300042593 Ga0466691_054711 Ga0466691_054711_655_1209 184
190 3300042636 Ga0466703_077197 Ga0466703_077197_5154_5726 190
191 3300005083 Ga0068305_10018320 Ga0068305_100183207 194
192 3300042609 Ga0466722_083098 Ga0466722_083098_169_753 194
193 3300042643 Ga0466704_460367 Ga0466704_460367_2923_3633 236

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region 41 160 0.97
PF14437 MafB19-deam MafB19-like deaminase 41 172 0.92

πŸ—οΈ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2hvv-assembly1.cif.gz_A Crystal structure of dCMP deaminase from Streptococcus mutans 0.902 40 190
4p9e-assembly1.cif.gz_A Crystal structure of dCMP deaminase from the cyanophage S-TIM5 in apo form 0.876 38 184
4p9c-assembly1.cif.gz_J Crystal structure of dCMP deaminase from the cyanophage S-TIM5 in complex with dCMP and dUMP 0.852 37 184
3sbo-assembly1.cif.gz_B Structure of E.coli GDH from native source 0.846 144 181
7tzi-assembly2.cif.gz_B Structure of a pseudomurein peptide ligase type E from Methanothermobacter thermautotrophicus 0.828 145 186
IDDescriptionScoreStartEndSuperfamily
2hvvA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9018 40 190 3.40.140.10
4p9eA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8757 38 184 3.40.140.10
4n0qD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8555 145 183 3.40.50.2300
af_P30648_42_197_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8481 42 186 3.40.140.10
1z15A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.848 145 183 3.40.50.2300
IDDescriptionScoreStartEndGO Terms
AF-A0A421K9M4-F1-model_v4 Uncharacterized/unreviewed 0.9773 48 192
AF-A0A0G1LJB7-F1-model_v4 Uncharacterized/unreviewed 0.977 114 184 GO:0003824

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.