Protein Family IF06777

Metagenome Isolate
149 Members
52 Samples
143 Scaffolds
333.23 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_080564|Ga0466722_080564_900_2054
Length
384 aa
Sequence
MKYGRRKRVSRRERFWLMFSPLPIFSQNLFAFWRILCYNGVYYIHYGGTYMKRLMILMLSLLIVAAGLWAQNTVSAYTTLEEPLAKALFEQFEKETGVKVSFVRLSGGEAVARMEAEAANPQASIWVGGVGLDHITAKSKNLTTPYQSRFAANTRAEFRDPQNYWIGLYVGPLTFVTNIDRAKALGLKAPASWADLLKPEYKGQIRMANPNISGTAYNVITTVRTLNNGNESAAFDYLKKLDANVDQYARSGSAPGKSVATGEIPIAIGYAHDQVKLKAEGANVEIHAPSEGTGYELASMSLIRNGKDQVNARRLYDWILSSPNSQKLFTDWYLVLVANGAAKHPLALSLDQIKTINQNMQWDGDAANKKRLLDRWTAEIESKR

πŸ“Š Sample Types

Isolate 4.0%
Metagenome 96.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 38.8%
Kalotermitidae 30.6%
Unclassified 14.3%
Rhinotermitidae 8.2%
Termopsidae 6.1%
Kiwaidae 2.0%

🌳 Taxonomy

Archaea 2
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
14 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
15 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
32 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
33 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
45 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
46 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
47 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
48 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
49 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
50 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
52 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0068305_10132018 3300005083 Bacteria 17470
2 Ga0466712_025557 3300042614 Bacteria 17046
3 Ga0466712_241290 3300042614 Unclassified 2062
4 Ga0466711_058137 3300042615 Bacteria 6820
5 Ga0466715_063470 3300042616 Bacteria 5060
6 Ga0466723_005924 3300042618 Bacteria 37995
7 Ga0466728_011601 3300042620 Bacteria 1890
8 Ga0466722_080564 3300042609 Bacteria 6768
9 Ga0466722_118601 3300042609 Bacteria 2222
10 Ga0466722_175775 3300042609 Bacteria 12144
11 Ga0123357_10154776 3300009784 Bacteria 2769
12 Ga0123353_10308865 3300010167 Bacteria 2408
13 Ga0123353_10793978 3300010167 Bacteria 1308
14 Ga0466735_045020 3300042624 Bacteria 1279
15 Ga0466708_304505 3300042652 Bacteria 15028
16 Ga0264413_113819 3300024493 Bacteria 3359
17 Ga0466690_152428 3300042590 Bacteria 1413
18 JGI24698J34947_10006203 3300002449 Unclassified 6569
19 JGI24702J35022_10003568 3300002462 Bacteria 9372
20 Ga0466712_023838 3300042614 Bacteria 27673
21 Ga0466718_094661 3300042617 Bacteria 2804
22 Ga0466723_135685 3300042618 Bacteria 4999
23 Ga0466719_068509 3300042606 Bacteria 1525
24 Ga0123355_10605706 3300009826 Bacteria 1298
25 Ga0123353_10180957 3300010167 Bacteria 3337
26 Ga0123353_10286850 3300010167 Bacteria 2523
27 Ga0466705_285768 3300042612 Bacteria 13287
28 Ga0466703_079403 3300042636 Bacteria 7085
29 Ga0466704_265143 3300042643 Bacteria 5726
30 Ga0466725_369002 3300042654 Bacteria 2501
31 Ga0466691_168095 3300042593 Bacteria 4193
32 JGI24695J34938_10000004 3300002450 Bacteria 163071
33 JGI24695J34938_10000175 3300002450 Bacteria 59525
34 JGI24702J35022_10109134 3300002462 Bacteria 1520
35 Ga0105524_104560 3300007733 Bacteria 1375
36 Ga0466712_165958 3300042614 Unclassified 3969
37 Ga0466712_222459 3300042614 Unclassified 1288
38 Ga0466711_239604 3300042615 Bacteria 24190
39 Ga0466726_007792 3300042619 Bacteria 1488
40 Ga0466726_222169 3300042619 Bacteria 24411
41 Ga0466719_377942 3300042606 Bacteria 2166
42 Ga0466722_056924 3300042609 Bacteria 3910
43 Ga0123356_10011999 3300010049 Bacteria 8430
44 Ga0123356_10318052 3300010049 Bacteria 1668
45 Ga0466703_219962 3300042636 Bacteria 3738
46 Ga0466708_142115 3300042652 Bacteria 5482
47 Ga0466692_139489 3300042591 Bacteria 5280
48 JGI24702J35022_10039693 3300002462 Bacteria 2511
49 JGI24705J35276_12182306 3300002504 Bacteria 1380
50 Ga0072941_1124266 3300005201 Bacteria 3575
51 Ga0466728_385228 3300042620 Bacteria 2250
52 Ga0466707_285921 3300042601 Bacteria 2706
53 Ga0466716_444681 3300042605 Bacteria 3651
54 Ga0466719_087711 3300042606 Bacteria 1801
55 Ga0466720_235371 3300042607 Bacteria 1837
56 Ga0123357_10014369 3300009784 Bacteria 10330
57 Ga0123353_10332436 3300010167 Bacteria 2299
58 Ga0466735_217485 3300042624 Bacteria 13131
59 Ga0466703_035816 3300042636 Bacteria 2045
60 Ga0466704_091887 3300042643 Bacteria 12423
61 Ga0466708_024940 3300042652 Bacteria 7078
62 Ga0466708_128149 3300042652 Bacteria 2216
63 Ga0466708_411218 3300042652 Bacteria 2221
64 Ga0157631_106730 3300013007 Bacteria 1829
65 JGI24698J34947_10012002 3300002449 Bacteria 4757
66 JGI24702J35022_10002961 3300002462 Bacteria 10276
67 Ga0466732_186155 3300042656 Bacteria 1562
68 Ga0466712_151863 3300042614 Bacteria 5858
69 Ga0466711_234119 3300042615 Bacteria 6582
70 Ga0466711_276940 3300042615 Bacteria 1359
71 Ga0466715_105607 3300042616 Unclassified 3622
72 Ga0466715_599867 3300042616 Bacteria 13066
73 Ga0466723_011241 3300042618 Bacteria 3428
74 Ga0466723_098434 3300042618 Bacteria 5783
75 Ga0466723_173822 3300042618 Bacteria 10345
76 Ga0466726_347661 3300042619 Bacteria 4383
77 Ga0466729_003508 3300042621 Bacteria 1386
78 Ga0466714_163543 3300042603 Bacteria 1358
79 Ga0466698_149552 3300042610 Archaea 2484
80 Ga0123357_10057164 3300009784 Bacteria 5243
81 Ga0123353_10306801 3300010167 Bacteria 2419
82 Ga0466705_275133 3300042612 Bacteria 7927
83 Ga0466734_021765 3300042623 Bacteria 2712
84 Ga0466704_057822 3300042643 Bacteria 25731
85 Ga0466709_272473 3300042648 Bacteria 16841
86 Ga0466708_035661 3300042652 Unclassified 1447
87 Ga0466708_107303 3300042652 Bacteria 25503
88 Ga0466690_213880 3300042590 Unclassified 7168
89 Ga0466692_056362 3300042591 Bacteria 29432
90 JGI24695J34938_10015936 3300002450 Bacteria 3841
91 Ga0466733_147908 3300042659 Bacteria 1598
92 Ga0466705_433588 3300042612 Bacteria 3198
93 Ga0466715_162001 3300042616 Bacteria 5546
94 Ga0466715_168583 3300042616 Bacteria 1669
95 Ga0466726_114851 3300042619 Bacteria 1554
96 Ga0466728_469356 3300042620 Bacteria 21291
97 Ga0123353_10123646 3300010167 Bacteria 4159
98 Ga0123353_10445367 3300010167 Bacteria 1909
99 Ga0466735_118873 3300042624 Bacteria 1388
100 Ga0466709_413156 3300042648 Bacteria 11426
101 Ga0466708_013441 3300042652 Bacteria 5380
102 Ga0264413_145226 3300024493 Archaea 2241
103 Ga0456237_0004605 3300041968 Bacteria 2211
104 Ga0466691_024325 3300042593 Bacteria 6698
105 Ga0466699_210927 3300042597 Bacteria 1234
106 JGI24698J34947_10005945 3300002449 Bacteria 6696
107 JGI24698J34947_10008074 3300002449 Unclassified 5777
108 JGI24698J34947_10032485 3300002449 Unclassified 2740
109 JGI24695J34938_10000575 3300002450 Bacteria 35379
110 JGI24695J34938_10001872 3300002450 Bacteria 17094
111 JGI24705J35276_12217102 3300002504 Bacteria 2077
112 Ga0466733_117561 3300042659 Bacteria 1582
113 Ga0466712_011054 3300042614 Bacteria 13445
114 Ga0466711_019243 3300042615 Bacteria 9461
115 Ga0466711_171166 3300042615 Bacteria 11426
116 Ga0466715_013707 3300042616 Bacteria 11090
117 Ga0466715_235178 3300042616 Bacteria 6786
118 Ga0466715_424244 3300042616 Bacteria 6404
119 Ga0466722_078508 3300042609 Bacteria 7178
120 Ga0123353_10030448 3300010167 Bacteria 8341
121 Ga0123353_10127189 3300010167 Bacteria 4094
122 Ga0123353_10148254 3300010167 Bacteria 3749
123 Ga0123353_10524865 3300010167 Bacteria 1717
124 Ga0466705_251057 3300042612 Bacteria 24177
125 Ga0466735_079383 3300042624 Bacteria 2261
126 Ga0466708_193808 3300042652 Bacteria 3104
127 Ga0466727_006435 3300042655 Unclassified 3303
128 Ga0466727_134177 3300042655 Bacteria 5322
129 Ga0466693_096271 3300042592 Bacteria 19508
130 Ga0466699_262626 3300042597 Bacteria 1939
131 Ga0466711_268681 3300042615 Bacteria 9243
132 Ga0466726_112487 3300042619 Bacteria 24629
133 Ga0466716_038725 3300042605 Bacteria 6495
134 Ga0466720_109853 3300042607 Bacteria 1305
135 Ga0466722_255318 3300042609 Bacteria 4950
136 Ga0123357_10145197 3300009784 Bacteria 2901
137 Ga0123353_10034997 3300010167 Bacteria 7849
138 Ga0123353_10311898 3300010167 Bacteria 2393
139 Ga0466705_369976 3300042612 Bacteria 4204
140 Ga0456237_0000139 3300041968 Bacteria 10620
141 Ga0466690_263465 3300042590 Bacteria 2057
142 Ga0466696_074913 3300042596 Unclassified 2502
143 Ga0466696_473634 3300042596 Bacteria 1247

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10605706 Ga0123355_106057062 305
2 3300007733 Ga0105524_104560 Ga0105524_1045601 311
3 3300010167 Ga0123353_10308865 Ga0123353_103088653 315
4 3300042652 Ga0466708_035661 Ga0466708_035661_485_1435 316
5 3300024493 Ga0264413_113819 Ga0264413_1138192 317
6 3300042591 Ga0466692_056362 Ga0466692_056362_7120_8076 318
7 3300042610 Ga0466698_149552 Ga0466698_149552_1452_2408 318
8 3300042612 Ga0466705_285768 Ga0466705_285768_7576_8532 318
9 3300042655 Ga0466727_006435 Ga0466727_006435_2117_3073 318
10 3300010167 Ga0123353_10524865 Ga0123353_105248652 319
11 3300042636 Ga0466703_035816 Ga0466703_035816_756_1757 319
12 3300005083 Ga0068305_10132018 Ga0068305_1013201816 320
13 3300010049 Ga0123356_10011999 Ga0123356_100119995 320
14 3300042603 Ga0466714_163543 Ga0466714_163543_247_1248 320
15 3300042616 Ga0466715_063470 Ga0466715_063470_2398_3417 320
16 3300042621 Ga0466729_003508 Ga0466729_003508_45_1007 320
17 3300002449 JGI24698J34947_10032485 JGI24698J34947_100324851 322
18 3300010167 Ga0123353_10306801 Ga0123353_103068012 322
19 3300010167 Ga0123353_10332436 Ga0123353_103324363 323
20 3300042619 Ga0466726_007792 Ga0466726_007792_406_1401 323
21 3300042601 Ga0466707_285921 Ga0466707_285921_68_1045 325
22 3300042618 Ga0466723_135685 Ga0466723_135685_638_1645 325
23 3300002462 JGI24702J35022_10109134 JGI24702J35022_101091342 327
24 3300042606 Ga0466719_087711 Ga0466719_087711_576_1559 327
25 3300042615 Ga0466711_268681 Ga0466711_268681_1825_2808 327
26 3300042656 Ga0466732_186155 Ga0466732_186155_359_1369 327
27 3300002462 JGI24702J35022_10002961 JGI24702J35022_100029613 328
28 3300002462 JGI24702J35022_10003568 JGI24702J35022_100035686 328
29 3300042606 Ga0466719_377942 Ga0466719_377942_465_1454 329
30 3300010167 Ga0123353_10445367 Ga0123353_104453672 330
31 3300042609 Ga0466722_078508 Ga0466722_078508_2000_2995 331
32 3300042619 Ga0466726_112487 Ga0466726_112487_425_1453 331
33 3300042643 Ga0466704_265143 Ga0466704_265143_3524_4519 331
34 3300042592 Ga0466693_096271 Ga0466693_096271_9891_10940 332
35 3300042618 Ga0466723_011241 Ga0466723_011241_1731_2729 332
36 iso_pr_bacteria 2781125652 2781312922 332
37 3300010167 Ga0123353_10180957 Ga0123353_101809572 333
38 3300041968 Ga0456237_0004605 Ga0456237_0004605_655_1656 333
39 3300042590 Ga0466690_263465 Ga0466690_263465_392_1393 333
40 3300042609 Ga0466722_056924 Ga0466722_056924_2402_3403 333
41 3300042655 Ga0466727_134177 Ga0466727_134177_3536_4537 333
42 3300042659 Ga0466733_117561 Ga0466733_117561_530_1531 333
43 3300042659 Ga0466733_147908 Ga0466733_147908_352_1353 333
44 iso_pr_bacteria 2820016619 2820017211 333
45 3300010167 Ga0123353_10030448 Ga0123353_100304484 334
46 3300024493 Ga0264413_145226 Ga0264413_1452263 334
47 3300041968 Ga0456237_0000139 Ga0456237_0000139_4453_5457 334
48 3300042590 Ga0466690_152428 Ga0466690_152428_213_1217 334
49 3300042590 Ga0466690_213880 Ga0466690_213880_2724_3728 334
50 3300042591 Ga0466692_139489 Ga0466692_139489_69_1073 334
51 3300042593 Ga0466691_024325 Ga0466691_024325_308_1312 334
52 3300042593 Ga0466691_168095 Ga0466691_168095_315_1319 334
53 3300042596 Ga0466696_074913 Ga0466696_074913_837_1841 334
54 3300042596 Ga0466696_473634 Ga0466696_473634_13_1017 334
55 3300042605 Ga0466716_038725 Ga0466716_038725_189_1193 334
56 3300042605 Ga0466716_444681 Ga0466716_444681_1939_2943 334
57 3300042607 Ga0466720_235371 Ga0466720_235371_157_1161 334
58 3300042609 Ga0466722_118601 Ga0466722_118601_292_1296 334
59 3300042609 Ga0466722_175775 Ga0466722_175775_5348_6352 334
60 3300042612 Ga0466705_251057 Ga0466705_251057_1798_2802 334
61 3300042614 Ga0466712_011054 Ga0466712_011054_3084_4088 334
62 3300042614 Ga0466712_023838 Ga0466712_023838_1448_2452 334
63 3300042614 Ga0466712_025557 Ga0466712_025557_14304_15308 334
64 3300042614 Ga0466712_151863 Ga0466712_151863_1668_2672 334
65 3300042614 Ga0466712_165958 Ga0466712_165958_1710_2714 334
66 3300042614 Ga0466712_222459 Ga0466712_222459_51_1055 334
67 3300042614 Ga0466712_241290 Ga0466712_241290_694_1698 334
68 3300042615 Ga0466711_058137 Ga0466711_058137_4021_5025 334
69 3300042615 Ga0466711_234119 Ga0466711_234119_733_1737 334
70 3300042615 Ga0466711_239604 Ga0466711_239604_16677_17681 334
71 3300042615 Ga0466711_276940 Ga0466711_276940_154_1158 334
72 3300042617 Ga0466718_094661 Ga0466718_094661_1203_2207 334
73 3300042618 Ga0466723_098434 Ga0466723_098434_3138_4142 334
74 3300042618 Ga0466723_173822 Ga0466723_173822_567_1571 334
75 3300042619 Ga0466726_114851 Ga0466726_114851_235_1239 334
76 3300042619 Ga0466726_222169 Ga0466726_222169_13777_14781 334
77 3300042619 Ga0466726_347661 Ga0466726_347661_3090_4094 334
78 3300042620 Ga0466728_011601 Ga0466728_011601_280_1284 334
79 3300042620 Ga0466728_385228 Ga0466728_385228_43_1047 334
80 3300042620 Ga0466728_469356 Ga0466728_469356_15774_16778 334
81 3300042623 Ga0466734_021765 Ga0466734_021765_845_1849 334
82 3300042624 Ga0466735_217485 Ga0466735_217485_686_1690 334
83 3300042636 Ga0466703_079403 Ga0466703_079403_1762_2766 334
84 3300042636 Ga0466703_219962 Ga0466703_219962_2218_3222 334
85 3300042643 Ga0466704_091887 Ga0466704_091887_6769_7773 334
86 3300042648 Ga0466709_413156 Ga0466709_413156_6794_7798 334
87 3300042652 Ga0466708_013441 Ga0466708_013441_1001_2005 334
88 3300042652 Ga0466708_024940 Ga0466708_024940_3273_4277 334
89 3300042652 Ga0466708_107303 Ga0466708_107303_9843_10847 334
90 3300042652 Ga0466708_193808 Ga0466708_193808_1112_2116 334
91 3300042652 Ga0466708_304505 Ga0466708_304505_7011_8015 334
92 3300042652 Ga0466708_411218 Ga0466708_411218_876_1880 334
93 iso_pr_bacteria 2781125681 2781407858 334
94 3300002449 JGI24698J34947_10005945 JGI24698J34947_100059451 335
95 3300002449 JGI24698J34947_10006203 JGI24698J34947_100062034 335
96 3300002449 JGI24698J34947_10008074 JGI24698J34947_100080744 335
97 3300002449 JGI24698J34947_10012002 JGI24698J34947_100120027 335
98 3300002450 JGI24695J34938_10000575 JGI24695J34938_1000057513 335
99 3300002450 JGI24695J34938_10001872 JGI24695J34938_100018727 335
100 3300002450 JGI24695J34938_10015936 JGI24695J34938_100159362 335
101 3300002462 JGI24702J35022_10039693 JGI24702J35022_100396931 335
102 3300002504 JGI24705J35276_12182306 JGI24705J35276_121823062 335
103 3300002504 JGI24705J35276_12217102 JGI24705J35276_122171022 335
104 3300005201 Ga0072941_1124266 Ga0072941_11242664 335
105 3300009784 Ga0123357_10145197 Ga0123357_101451972 335
106 3300010049 Ga0123356_10318052 Ga0123356_103180521 335
107 3300010167 Ga0123353_10286850 Ga0123353_102868502 335
108 3300010167 Ga0123353_10793978 Ga0123353_107939782 335
109 3300042606 Ga0466719_068509 Ga0466719_068509_411_1418 335
110 3300042616 Ga0466715_013707 Ga0466715_013707_1131_2138 335
111 3300042616 Ga0466715_168583 Ga0466715_168583_69_1076 335
112 3300042616 Ga0466715_424244 Ga0466715_424244_2632_3639 335
113 3300042648 Ga0466709_272473 Ga0466709_272473_4104_5111 335
114 3300042652 Ga0466708_128149 Ga0466708_128149_845_1852 335
115 3300042652 Ga0466708_142115 Ga0466708_142115_371_1378 335
116 iso_pr_bacteria 2781125647 2781302638 335
117 3300002450 JGI24695J34938_10000175 JGI24695J34938_1000017518 336
118 3300009784 Ga0123357_10014369 Ga0123357_1001436912 336
119 3300042624 Ga0466735_045020 Ga0466735_045020_57_1067 336
120 3300042624 Ga0466735_079383 Ga0466735_079383_1128_2138 336
121 3300042654 Ga0466725_369002 Ga0466725_369002_179_1189 336
122 3300042616 Ga0466715_599867 Ga0466715_599867_2206_3258 337
123 3300042609 Ga0466722_255318 Ga0466722_255318_1924_2940 338
124 3300042612 Ga0466705_433588 Ga0466705_433588_1915_2931 338
125 3300042615 Ga0466711_171166 Ga0466711_171166_3409_4425 338
126 3300042616 Ga0466715_235178 Ga0466715_235178_5128_6144 338
127 3300042618 Ga0466723_005924 Ga0466723_005924_793_1809 338
128 3300009784 Ga0123357_10154776 Ga0123357_101547761 339
129 3300010167 Ga0123353_10034997 Ga0123353_100349973 339
130 3300010167 Ga0123353_10123646 Ga0123353_101236462 339
131 3300010167 Ga0123353_10127189 Ga0123353_101271892 339
132 3300010167 Ga0123353_10148254 Ga0123353_101482542 339
133 3300042612 Ga0466705_275133 Ga0466705_275133_2290_3309 339
134 3300042612 Ga0466705_369976 Ga0466705_369976_3075_4097 340
135 3300042616 Ga0466715_105607 Ga0466715_105607_170_1192 340
136 3300042616 Ga0466715_162001 Ga0466715_162001_1572_2594 340
137 3300042624 Ga0466735_118873 Ga0466735_118873_286_1311 341
138 3300009784 Ga0123357_10057164 Ga0123357_100571642 342
139 3300010167 Ga0123353_10311898 Ga0123353_103118982 342
140 3300013007 Ga0157631_106730 Ga0157631_1067302 343
141 3300042597 Ga0466699_210927 Ga0466699_210927_15_1046 343
142 3300042615 Ga0466711_019243 Ga0466711_019243_6669_7700 343
143 3300042597 Ga0466699_262626 Ga0466699_262626_92_1129 345
144 iso_pr_bacteria 2503904012 2503956542 346
145 iso_pr_bacteria 2781125644 2781294904 346
146 3300002450 JGI24695J34938_10000004 JGI24695J34938_10000004136 347
147 3300042607 Ga0466720_109853 Ga0466720_109853_48_1106 352
148 3300042643 Ga0466704_057822 Ga0466704_057822_3835_4902 355
149 3300042609 Ga0466722_080564 Ga0466722_080564_900_2054 384

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein 137 331 0.84
PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein 87 342 0.81
PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein 73 331 0.81
PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein 84 323 0.78

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.