Protein Family IF06749

Metagenome Metatranscriptome Isolate
162 Members
47 Samples
157 Scaffolds
284.6 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_048903|Ga0466722_048903_1062_2126
Length
336 aa
Sequence
MSVKQKVVFADIGGMSSILGFVFRRQVRIFCGVAFVLVFTAQSFAESREHTVQSGETAYTLARRYGVRPEEILFINGIEDARKIKVGQKLRIPEGNTMARPALDNGVEPPPVIVAHTAVNGDTLYGIARKYGITYQALVDANNFSKDKKLKIGERVNVPVPASVPANSGSAEAVPALAAAGNESGLPVNKMAAPIGKQQVQAPIKTGVAAKPAGRQVDLKLKWPVRIKDAAYMTGKLDGVVLTGEKAASVQSLSAGTVASAGPYRGFGRVAIVQSDSGYIYVYGGCETLSVRAGERIAAGSEIGRLGVDAVSQKPQLFFMVYNGTKAIDPAKAPRA

📊 Sample Types

Isolate 3.1%
Metagenome 96.3%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.5%
Kalotermitidae 30.4%
Unclassified 13.0%
Termopsidae 6.5%
Rhinotermitidae 4.3%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 160
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
2 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
3 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
4 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
5 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
6 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
7 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
8 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
9 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
22 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
23 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
24 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
25 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
26 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
29 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
32 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
33 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
34 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
37 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
40 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
41 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
42 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
43 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
44 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
45 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
46 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10184455 3300009784 Bacteria 2425
2 Ga0123356_10608097 3300010049 Bacteria 1258
3 Ga0123353_10480481 3300010167 Bacteria 1818
4 Ga0123354_10175337 3300010882 Bacteria 2474
5 Ga0466711_173907 3300042615 Bacteria 1628
6 Ga0466715_592267 3300042616 Bacteria 17861
7 Ga0466718_150093 3300042617 Bacteria 1153
8 Ga0466723_141476 3300042618 Bacteria 6613
9 Ga0466723_190538 3300042618 Bacteria 9581
10 Ga0466723_374405 3300042618 Bacteria 1535
11 Ga0466728_464994 3300042620 Bacteria 14752
12 Ga0255786_1024856 3300022815 Bacteria 1331
13 Ga0466690_032423 3300042590 Bacteria 5059
14 Ga0466692_054086 3300042591 Bacteria 5153
15 Ga0466692_067977 3300042591 Bacteria 15699
16 Ga0466691_072650 3300042593 Bacteria 4725
17 Ga0466699_370677 3300042597 Bacteria 6829
18 Ga0466719_418728 3300042606 Bacteria 36150
19 Ga0466720_068889 3300042607 Bacteria 7067
20 Ga0466703_370311 3300042636 Bacteria 15744
21 Ga0466709_015042 3300042648 Bacteria 1545
22 Ga0466708_002059 3300042652 Bacteria 10518
23 Ga0072941_1329632 3300005201 Bacteria 1387
24 Ga0123353_10128920 3300010167 Bacteria 4062
25 Ga0466712_047845 3300042614 Bacteria 13706
26 Ga0466715_000668 3300042616 Bacteria 11725
27 Ga0466715_200488 3300042616 Bacteria 3209
28 Ga0466718_027146 3300042617 Bacteria 1149
29 Ga0466723_365116 3300042618 Bacteria 3858
30 Ga0466728_163226 3300042620 Bacteria 3801
31 Ga0466692_066107 3300042591 Bacteria 9614
32 Ga0466692_102496 3300042591 Bacteria 6892
33 Ga0466692_120882 3300042591 Bacteria 3840
34 Ga0466691_148977 3300042593 Bacteria 2542
35 Ga0466695_161607 3300042595 Bacteria 1373
36 Ga0466696_294679 3300042596 Bacteria 4328
37 Ga0466696_363841 3300042596 Bacteria 2234
38 Ga0466706_241686 3300042599 Bacteria 1104
39 Ga0466719_100135 3300042606 Bacteria 2032
40 Ga0466719_107013 3300042606 Bacteria 7234
41 Ga0466719_124329 3300042606 Bacteria 3742
42 Ga0466722_097331 3300042609 Bacteria 79624
43 Ga0466702_200538 3300042635 Bacteria 14051
44 Ga0466708_217800 3300042652 Bacteria 27433
45 Ga0466727_311482 3300042655 Bacteria 2875
46 JGI24698J34947_10012326 3300002449 Bacteria 4686
47 Ga0466705_011940 3300042612 Bacteria 3059
48 Ga0466732_202370 3300042656 Bacteria 3146
49 Ga0123356_10051886 3300010049 Bacteria 3815
50 Ga0123353_10200476 3300010167 Bacteria 3140
51 Ga0466718_030652 3300042617 Bacteria 8310
52 Ga0466728_217926 3300042620 Bacteria 7283
53 Ga0466690_299911 3300042590 Bacteria 2769
54 Ga0466692_180380 3300042591 Bacteria 3156
55 Ga0466693_028489 3300042592 Bacteria 28385
56 Ga0466716_297880 3300042605 Bacteria 2267
57 Ga0466720_096016 3300042607 Bacteria 7198
58 Ga0466722_048903 3300042609 Bacteria 2612
59 Ga0466703_153800 3300042636 Bacteria 17216
60 Ga0466703_263014 3300042636 Bacteria 15134
61 Ga0466709_080691 3300042648 Bacteria 9995
62 Ga0123356_10004605 3300010049 Bacteria 14210
63 Ga0123353_10210911 3300010167 Bacteria 3046
64 Ga0466715_005887 3300042616 Bacteria 3289
65 Ga0466723_097146 3300042618 Bacteria 9188
66 Ga0466723_102621 3300042618 Bacteria 3651
67 Ga0466692_093846 3300042591 Bacteria 17043
68 Ga0466696_044431 3300042596 Bacteria 2298
69 Ga0466699_024094 3300042597 Bacteria 2733
70 Ga0466719_093752 3300042606 Bacteria 6910
71 Ga0466702_402423 3300042635 Bacteria 2133
72 Ga0466703_189991 3300042636 Bacteria 8633
73 Ga0466704_244203 3300042643 Bacteria 8975
74 Ga0466708_040910 3300042652 Unclassified 3399
75 Ga0466708_135875 3300042652 Bacteria 4426
76 Ga0466708_198639 3300042652 Bacteria 9642
77 Ga0466708_341935 3300042652 Bacteria 2117
78 Ga0466727_210070 3300042655 Bacteria 3493
79 AustNasuHG_c1018515 3300000089 Bacteria 2297
80 JGI24702J35022_10001234 3300002462 Bacteria 15932
81 JGI24702J35022_10039965 3300002462 Bacteria 2502
82 Ga0466705_156874 3300042612 Bacteria 9841
83 Ga0466711_025285 3300042615 Bacteria 3769
84 Ga0466715_017184 3300042616 Bacteria 2806
85 Ga0466718_043350 3300042617 Bacteria 1264
86 Ga0466718_049284 3300042617 Bacteria 5267
87 Ga0466718_064276 3300042617 Bacteria 3470
88 Ga0466718_087399 3300042617 Bacteria 20374
89 Ga0466718_142235 3300042617 Bacteria 1790
90 Ga0466726_348171 3300042619 Bacteria 5987
91 Ga0466728_103149 3300042620 Bacteria 8224
92 Ga0466728_235590 3300042620 Bacteria 3995
93 Ga0466690_002788 3300042590 Bacteria 26421
94 Ga0466694_188429 3300042594 Bacteria 57168
95 Ga0466696_054348 3300042596 Bacteria 3074
96 Ga0466707_363361 3300042601 Bacteria 1324
97 Ga0466722_223972 3300042609 Bacteria 1444
98 Ga0466704_141059 3300042643 Bacteria 4105
99 Ga0466704_264522 3300042643 Bacteria 19667
100 Ga0466708_004910 3300042652 Bacteria 5911
101 Ga0466708_312416 3300042652 Bacteria 85118
102 Ga0466727_129467 3300042655 Bacteria 1942
103 JGI24702J35022_10001511 3300002462 Bacteria 14441
104 Ga0466732_075598 3300042656 Bacteria 4579
105 Ga0466711_317791 3300042615 Bacteria 2564
106 Ga0466715_005024 3300042616 Bacteria 8146
107 Ga0466715_026977 3300042616 Bacteria 8369
108 Ga0466723_122593 3300042618 Bacteria 7404
109 Ga0466726_287810 3300042619 Bacteria 2010
110 Ga0415639_063056 3300038395 Bacteria 1143
111 Ga0415639_137242 3300038395 Bacteria 1481
112 Ga0466691_066487 3300042593 Bacteria 11965
113 Ga0466707_319525 3300042601 Bacteria 10271
114 Ga0466719_334832 3300042606 Bacteria 5109
115 Ga0466722_191015 3300042609 Bacteria 2950
116 Ga0466722_198434 3300042609 Bacteria 2904
117 Ga0466709_237573 3300042648 Bacteria 17749
118 Ga0072941_1089056 3300005201 Bacteria 1575
119 Ga0466705_295321 3300042612 Bacteria 8627
120 Ga0466732_034414 3300042656 Bacteria 5941
121 Ga0466718_121137 3300042617 Bacteria 3713
122 Ga0466728_177495 3300042620 Bacteria 1739
123 Ga0466692_149841 3300042591 Bacteria 1987
124 Ga0466692_179439 3300042591 Bacteria 1554
125 Ga0466695_126976 3300042595 Bacteria 4567
126 Ga0466722_184247 3300042609 Bacteria 2940
127 Ga0466722_193529 3300042609 Bacteria 30621
128 Ga0466702_075005 3300042635 Bacteria 1742
129 Ga0466704_189303 3300042643 Bacteria 9296
130 Ga0466708_266872 3300042652 Bacteria 3617
131 JGI24695J34938_10003194 3300002450 Bacteria 11619
132 Ga0072940_1009028 3300005200 Bacteria 5628
133 Ga0466705_017705 3300042612 Bacteria 12912
134 Ga0123357_10083568 3300009784 Bacteria 4190
135 Ga0123356_10058440 3300010049 Bacteria 3596
136 Ga0466712_040280 3300042614 Bacteria 9433
137 Ga0466712_181889 3300042614 Bacteria 2469
138 Ga0466715_327224 3300042616 Bacteria 1749
139 Ga0466715_471919 3300042616 Bacteria 1308
140 Ga0466718_014320 3300042617 Bacteria 3875
141 Ga0466718_015756 3300042617 Bacteria 1646
142 Ga0466718_066130 3300042617 Bacteria 1608
143 Ga0466723_254144 3300042618 Bacteria 1895
144 Ga0466723_280654 3300042618 Bacteria 24305
145 Ga0466726_174213 3300042619 Unclassified 28101
146 Ga0466728_204789 3300042620 Bacteria 4277
147 Ga0466692_061336 3300042591 Bacteria 1295
148 Ga0466706_104935 3300042599 Bacteria 2120
149 Ga0466722_127138 3300042609 Bacteria 4358
150 Ga0466722_251605 3300042609 Bacteria 2665
151 Ga0466735_196552 3300042624 Bacteria 20904
152 Ga0466709_058843 3300042648 Bacteria 3656
153 Ga0466709_334453 3300042648 Bacteria 2610
154 Ga0466708_092476 3300042652 Bacteria 25952
155 Ga0466708_412239 3300042652 Bacteria 12537
156 Ga0072940_1040999 3300005200 Bacteria 1748
157 Ga0072941_1022880 3300005201 Bacteria 13997

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_121137 Ga0466718_121137_1893_2729 241
2 3300042656 Ga0466732_202370 Ga0466732_202370_1422_2276 259
3 3300042617 Ga0466718_066130 Ga0466718_066130_525_1403 260
4 3300005200 Ga0072940_1040999 Ga0072940_10409992 269
5 3300010167 Ga0123353_10210911 Ga0123353_102109114 269
6 3300042609 Ga0466722_223972 Ga0466722_223972_395_1306 269
7 3300042618 Ga0466723_097146 Ga0466723_097146_1706_2569 269
8 3300002449 JGI24698J34947_10012326 JGI24698J34947_100123264 270
9 3300002462 JGI24702J35022_10039965 JGI24702J35022_100399652 270
10 3300042597 Ga0466699_370677 Ga0466699_370677_5817_6746 270
11 3300042617 Ga0466718_014320 Ga0466718_014320_1012_1851 270
12 3300042619 Ga0466726_174213 Ga0466726_174213_7088_7981 270
13 3300042635 Ga0466702_200538 Ga0466702_200538_10725_11561 270
14 3300042652 Ga0466708_341935 Ga0466708_341935_584_1489 270
15 3300002450 JGI24695J34938_10003194 JGI24695J34938_100031947 271
16 3300010049 Ga0123356_10058440 Ga0123356_100584403 271
17 3300042614 Ga0466712_047845 Ga0466712_047845_6736_7584 271
18 3300042615 Ga0466711_317791 Ga0466711_317791_1022_1903 271
19 3300042652 Ga0466708_002059 Ga0466708_002059_4326_5180 271
20 3300042606 Ga0466719_107013 Ga0466719_107013_604_1422 272
21 3300042616 Ga0466715_592267 Ga0466715_592267_4188_5024 272
22 3300042617 Ga0466718_087399 Ga0466718_087399_3763_4632 272
23 3300042652 Ga0466708_217800 Ga0466708_217800_12828_13691 272
24 3300042652 Ga0466708_266872 Ga0466708_266872_1758_2696 272
25 3300005201 Ga0072941_1329632 Ga0072941_13296322 273
26 3300042591 Ga0466692_066107 Ga0466692_066107_7764_8711 273
27 3300042591 Ga0466692_093846 Ga0466692_093846_7488_8498 273
28 3300042595 Ga0466695_161607 Ga0466695_161607_451_1299 273
29 3300042601 Ga0466707_319525 Ga0466707_319525_8683_9567 273
30 3300042606 Ga0466719_334832 Ga0466719_334832_1846_2778 273
31 3300010049 Ga0123356_10004605 Ga0123356_1000460513 274
32 3300042615 Ga0466711_173907 Ga0466711_173907_56_976 274
33 3300042616 Ga0466715_005887 Ga0466715_005887_761_1669 274
34 3300042617 Ga0466718_043350 Ga0466718_043350_103_927 274
35 3300042618 Ga0466723_141476 Ga0466723_141476_1549_2454 274
36 3300042620 Ga0466728_163226 Ga0466728_163226_1585_2436 274
37 3300042620 Ga0466728_217926 Ga0466728_217926_5424_6323 274
38 3300042591 Ga0466692_149841 Ga0466692_149841_390_1265 275
39 3300042614 Ga0466712_181889 Ga0466712_181889_1063_1950 275
40 3300042590 Ga0466690_299911 Ga0466690_299911_1669_2499 276
41 3300042606 Ga0466719_093752 Ga0466719_093752_1292_2161 276
42 3300042615 Ga0466711_025285 Ga0466711_025285_1601_2470 276
43 3300042616 Ga0466715_000668 Ga0466715_000668_5260_6144 276
44 3300042620 Ga0466728_235590 Ga0466728_235590_1218_2111 276
45 3300042652 Ga0466708_040910 Ga0466708_040910_2389_3339 276
46 3300010049 Ga0123356_10051886 Ga0123356_100518862 277
47 3300038395 Ga0415639_137242 Ga0415639_137242_450_1361 277
48 3300042609 Ga0466722_193529 Ga0466722_193529_21363_22196 277
49 3300042609 Ga0466722_251605 Ga0466722_251605_572_1504 277
50 3300042617 Ga0466718_150093 Ga0466718_150093_103_960 277
51 3300042596 Ga0466696_294679 Ga0466696_294679_524_1360 278
52 3300042617 Ga0466718_142235 Ga0466718_142235_859_1749 278
53 3300042618 Ga0466723_190538 Ga0466723_190538_5494_6411 278
54 3300042620 Ga0466728_103149 Ga0466728_103149_3360_4247 278
55 3300042636 Ga0466703_153800 Ga0466703_153800_7230_8141 278
56 3300042652 Ga0466708_412239 Ga0466708_412239_10054_10890 278
57 3300042591 Ga0466692_054086 Ga0466692_054086_1605_2444 279
58 3300042617 Ga0466718_027146 Ga0466718_027146_229_1122 279
59 3300042652 Ga0466708_135875 Ga0466708_135875_1054_1947 279
60 3300042655 Ga0466727_129467 Ga0466727_129467_571_1440 279
61 iso_pr_bacteria 2781125635 2781278013 279
62 iso_pr_bacteria 2781125645 2781299842 279
63 3300002462 JGI24702J35022_10001511 JGI24702J35022_100015117 280
64 3300042620 Ga0466728_177495 Ga0466728_177495_446_1327 280
65 3300042624 Ga0466735_196552 Ga0466735_196552_17423_18397 280
66 3300005201 Ga0072941_1089056 Ga0072941_10890562 281
67 3300010049 Ga0123356_10608097 Ga0123356_106080971 281
68 3300042591 Ga0466692_179439 Ga0466692_179439_664_1509 281
69 3300042595 Ga0466695_126976 Ga0466695_126976_78_947 281
70 3300042597 Ga0466699_024094 Ga0466699_024094_772_1686 281
71 3300042607 Ga0466720_068889 Ga0466720_068889_3075_3965 281
72 3300042619 Ga0466726_287810 Ga0466726_287810_746_1591 281
73 3300042635 Ga0466702_075005 Ga0466702_075005_503_1375 281
74 3300042635 Ga0466702_402423 Ga0466702_402423_1220_2065 281
75 3300042655 Ga0466727_210070 Ga0466727_210070_2218_3165 281
76 3300042655 Ga0466727_311482 Ga0466727_311482_1274_2173 281
77 3300042594 Ga0466694_188429 Ga0466694_188429_47919_48767 282
78 3300042599 Ga0466706_241686 Ga0466706_241686_92_1060 282
79 3300042619 Ga0466726_348171 Ga0466726_348171_3650_4582 282
80 3300042643 Ga0466704_189303 Ga0466704_189303_672_1655 282
81 3300042643 Ga0466704_244203 Ga0466704_244203_5345_6193 282
82 3300042609 Ga0466722_097331 Ga0466722_097331_12495_13346 283
83 3300042617 Ga0466718_015756 Ga0466718_015756_595_1446 283
84 3300042636 Ga0466703_370311 Ga0466703_370311_7107_8003 283
85 3300042648 Ga0466709_015042 Ga0466709_015042_445_1296 283
86 3300042648 Ga0466709_237573 Ga0466709_237573_7607_8551 283
87 3300002462 JGI24702J35022_10001234 JGI24702J35022_1000123411 284
88 3300005201 Ga0072941_1022880 Ga0072941_10228805 284
89 3300010167 Ga0123353_10128920 Ga0123353_101289203 284
90 3300042591 Ga0466692_180380 Ga0466692_180380_974_1885 284
91 3300042593 Ga0466691_148977 Ga0466691_148977_630_1508 284
92 3300042601 Ga0466707_363361 Ga0466707_363361_418_1305 285
93 3300042609 Ga0466722_191015 Ga0466722_191015_78_1070 285
94 3300042612 Ga0466705_295321 Ga0466705_295321_5214_6071 285
95 3300042618 Ga0466723_122593 Ga0466723_122593_4788_5645 285
96 3300042648 Ga0466709_080691 Ga0466709_080691_4986_5843 285
97 3300042648 Ga0466709_334453 Ga0466709_334453_810_1727 285
98 3300010167 Ga0123353_10200476 Ga0123353_102004763 286
99 3300042593 Ga0466691_066487 Ga0466691_066487_530_1390 286
100 3300042614 Ga0466712_040280 Ga0466712_040280_2947_3918 286
101 3300042616 Ga0466715_200488 Ga0466715_200488_840_1700 286
102 3300042616 Ga0466715_327224 Ga0466715_327224_245_1105 286
103 3300042652 Ga0466708_312416 Ga0466708_312416_72924_73784 286
104 3300005200 Ga0072940_1009028 Ga0072940_10090284 287
105 3300042607 Ga0466720_096016 Ga0466720_096016_1461_2345 287
106 3300042609 Ga0466722_127138 Ga0466722_127138_1503_2444 287
107 3300042612 Ga0466705_156874 Ga0466705_156874_6709_7572 287
108 3300042617 Ga0466718_030652 Ga0466718_030652_2226_3089 287
109 3300042618 Ga0466723_254144 Ga0466723_254144_374_1237 287
110 3300042636 Ga0466703_189991 Ga0466703_189991_2686_3591 287
111 iso_pr_bacteria 2781125697 2781444441 287
112 3300042616 Ga0466715_017184 Ga0466715_017184_1050_1961 288
113 3300042648 Ga0466709_058843 Ga0466709_058843_621_1643 288
114 3300022815 Ga0255786_1024856 Ga0255786_10248561 289
115 3300038395 Ga0415639_063056 Ga0415639_063056_76_996 289
116 3300042609 Ga0466722_198434 Ga0466722_198434_1302_2255 289
117 3300042612 Ga0466705_011940 Ga0466705_011940_1551_2468 289
118 3300042612 Ga0466705_017705 Ga0466705_017705_2770_3675 289
119 3300042652 Ga0466708_198639 Ga0466708_198639_6937_7806 289
120 3300042620 Ga0466728_464994 Ga0466728_464994_12712_13605 290
121 3300042643 Ga0466704_141059 Ga0466704_141059_1545_2438 290
122 3300042656 Ga0466732_034414 Ga0466732_034414_1462_2334 290
123 3300000089 AustNasuHG_c1018515 AustNasuHG_10185152 291
124 3300042599 Ga0466706_104935 Ga0466706_104935_755_1633 292
125 3300010882 Ga0123354_10175337 Ga0123354_101753372 293
126 3300042592 Ga0466693_028489 Ga0466693_028489_1993_2874 293
127 3300042643 Ga0466704_264522 Ga0466704_264522_13876_14757 293
128 3300009784 Ga0123357_10083568 Ga0123357_100835684 294
129 3300042590 Ga0466690_002788 Ga0466690_002788_23410_24294 294
130 3300042591 Ga0466692_120882 Ga0466692_120882_2333_3217 294
131 3300042593 Ga0466691_072650 Ga0466691_072650_1325_2236 294
132 3300042609 Ga0466722_184247 Ga0466722_184247_967_1851 294
133 3300042618 Ga0466723_280654 Ga0466723_280654_6267_7151 294
134 3300042618 Ga0466723_374405 Ga0466723_374405_122_1024 295
135 3300042596 Ga0466696_363841 Ga0466696_363841_300_1235 296
136 3300042656 Ga0466732_075598 Ga0466732_075598_2160_3050 296
137 3300042616 Ga0466715_471919 Ga0466715_471919_382_1275 297
138 3300042636 Ga0466703_263014 Ga0466703_263014_6616_7551 297
139 3300042652 Ga0466708_092476 Ga0466708_092476_16272_17207 297
140 3300042618 Ga0466723_102621 Ga0466723_102621_1500_2462 298
141 3300009784 Ga0123357_10184455 Ga0123357_101844552 299
142 3300042617 Ga0466718_064276 Ga0466718_064276_533_1432 299
143 3300042591 Ga0466692_061336 Ga0466692_061336_190_1092 300
144 3300042616 Ga0466715_005024 Ga0466715_005024_5905_6807 300
145 3300042616 Ga0466715_026977 Ga0466715_026977_728_1630 300
146 3300042617 Ga0466718_049284 Ga0466718_049284_444_1346 300
147 3300042618 Ga0466723_365116 Ga0466723_365116_1088_1990 300
148 3300042591 Ga0466692_102496 Ga0466692_102496_3927_4832 301
149 3300010167 Ga0123353_10480481 Ga0123353_104804812 302
150 3300042606 Ga0466719_124329 Ga0466719_124329_2406_3335 302
151 3300042652 Ga0466708_004910 Ga0466708_004910_970_1920 303
152 3300042590 Ga0466690_032423 Ga0466690_032423_3898_4812 304
153 iso_pr_bacteria 2781125630 2781266641 305
154 3300042606 Ga0466719_100135 Ga0466719_100135_689_1618 309
155 3300042605 Ga0466716_297880 Ga0466716_297880_179_1138 311
156 iso_pr_bacteria 2781125629 2781264750 312
157 3300042620 Ga0466728_204789 Ga0466728_204789_1900_2868 313
158 3300042596 Ga0466696_044431 Ga0466696_044431_663_1610 315
159 3300042596 Ga0466696_054348 Ga0466696_054348_734_1681 315
160 3300042591 Ga0466692_067977 Ga0466692_067977_10440_11405 321
161 3300042609 Ga0466722_048903 Ga0466722_048903_1062_2126 336
162 3300042606 Ga0466719_418728 Ga0466719_418728_19533_20582 349

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01476 LysM LysM domain 50 93 0.99
PF01551 Peptidase_M23 Peptidase family M23 238 330 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.48 0.63 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.