Protein Family IF06732
Metagenome
Isolate
297
Members
178
Samples
197
Scaffolds
397.09
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_019854|Ga0466722_019854_19584_20852
- Length
- 422 aa
- Sequence
- MATATRPAVARSAPKKPESKVKNVKTYTYLWIGKNKTGKIIRGEIQAQSPTVVNAMLRRQGVLVTKITKKASGGGGKVAEKDIAMFTRQLATMMRAGVPLLQTFEIVGRGHDNPAVGKLLLDIKGDVETGSSLSQAFRKFPLHFDALYCNLVEAGEQAGILETLLDRLATYKEKMLAIKAKIKSALFYPTAILIVAFIITTVIMIFVIPAFKDIFKSFGADLPTPTIIVIAMSDFFMAYWWAIFGGLGGAIWAFFFAWRRSVPMQIAFDRLFLRLPLFGDIIRKAVIARWTRTLATMFAAGVPLVESLDSVAGAAGNYVYKIATQQIQEEVSTGISLTSAMQNRGEIFSNMVLQMVAIGEESGSLDSMLDKVAAIFEQEVDDAVEALSSLMEPVIMVILGVLIGGLVIAMYLPIFKLGSVVS
Sample Types
Isolate
33.7%
Metagenome
66.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
40.6%
Termitidae
11.8%
Unclassified
11.8%
Kalotermitidae
7.6%
Formicidae
7.1%
Curculionidae
4.7%
Elmidae
4.1%
Culicidae
4.1%
Armadillidiidae
2.9%
Rhinotermitidae
2.4%
Drosophilidae
1.2%
Hodotermitidae
0.6%
Alydidae
0.6%
Termopsidae
0.6%
Taxonomy
Archaea
0
Bacteria
284
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 2 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 3 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 4 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 5 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 6 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 7 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 8 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 9 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 10 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 11 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 12 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 15 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 16 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 17 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 18 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 19 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 20 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 21 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 22 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 23 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 24 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 25 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 26 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 27 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 28 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 31 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 32 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 33 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 38 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 42 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 47 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 48 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 49 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 50 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 51 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 52 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 53 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 54 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 55 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 56 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 57 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 58 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 59 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 60 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 61 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 62 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 63 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 64 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 65 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 66 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 67 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 68 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 69 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 70 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 71 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 72 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 73 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 74 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 75 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 76 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 77 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 78 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 79 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 80 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 81 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 82 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 83 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 84 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 85 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 86 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 87 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 88 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 89 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 90 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 91 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 92 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 93 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 94 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 95 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 96 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 97 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 98 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 99 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 100 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 101 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 102 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 103 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 104 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 105 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 106 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 107 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 108 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 109 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 110 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 111 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 112 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 113 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 114 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 115 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 116 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 117 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 118 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 119 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 120 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 121 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 122 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 123 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 124 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 125 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 126 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 127 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 128 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 129 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 130 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 131 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 132 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 133 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 134 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 135 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 136 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 137 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 138 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 139 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 140 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 141 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 142 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 143 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 144 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 145 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 146 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 147 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 148 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 149 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 150 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 151 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 152 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 153 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 154 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 155 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 156 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 157 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 158 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 159 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 160 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 161 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 162 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 163 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 164 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 165 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 166 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 167 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 168 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 169 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 170 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 171 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 172 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 173 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 174 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 175 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 176 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 177 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 178 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_274924 | 3300042615 | Bacteria | 7951 |
| 2 | Ga0466715_642030 | 3300042616 | Bacteria | 2633 |
| 3 | Ga0160458_100533 | 3300012832 | Bacteria | 14993 |
| 4 | Ga0160445_100440 | 3300012847 | Bacteria | 21713 |
| 5 | Ga0466657_113751 | 3300042582 | Bacteria | 130632 |
| 6 | Ga0466695_129374 | 3300042595 | Bacteria | 4415 |
| 7 | JGI24702J35022_10006501 | 3300002462 | Bacteria | 6757 |
| 8 | Ga0102739_1002778 | 3300007095 | Bacteria | 2639 |
| 9 | Ga0102734_1003684 | 3300007129 | Bacteria | 3468 |
| 10 | Ga0105005_1025082 | 3300007505 | Bacteria | 4042 |
| 11 | Ga0123353_10029880 | 3300010167 | Bacteria | 8409 |
| 12 | Ga0160471_100170 | 3300012812 | Unclassified | 24130 |
| 13 | Ga0466731_385469 | 3300042622 | Bacteria | 8390 |
| 14 | Ga0466703_358206 | 3300042636 | Bacteria | 4837 |
| 15 | Ga0466709_010413 | 3300042648 | Bacteria | 12589 |
| 16 | Ga0466724_06181 | 3300042649 | Bacteria | 92232 |
| 17 | Ga0466724_42462 | 3300042649 | Bacteria | 351483 |
| 18 | Ga0466725_018502 | 3300042654 | Bacteria | 7981 |
| 19 | Ga0466725_097523 | 3300042654 | Bacteria | 38110 |
| 20 | Ga0466701_059470 | 3300042598 | Bacteria | 19474 |
| 21 | Ga0466707_320088 | 3300042601 | Bacteria | 37959 |
| 22 | Ga0466717_080361 | 3300042604 | Unclassified | 5322 |
| 23 | Ga0466719_554150 | 3300042606 | Bacteria | 5553 |
| 24 | Ga0466705_492298 | 3300042612 | Bacteria | 1611 |
| 25 | Ga0466710_026092 | 3300042613 | Bacteria | 2459 |
| 26 | Ga0466726_012380 | 3300042619 | Bacteria | 29810 |
| 27 | Ga0160433_100121 | 3300012846 | Bacteria | 73825 |
| 28 | Ga0466657_084316 | 3300042582 | Bacteria | 3040 |
| 29 | Ga0466692_201209 | 3300042591 | Bacteria | 1941 |
| 30 | DPO_contig07613 | 2032320009 | Bacteria | 30829 |
| 31 | HBC_ctgsDRAFT_1007297 | 3300000333 | Bacteria | 2601 |
| 32 | Ga0072941_1082789 | 3300005201 | Bacteria | 17052 |
| 33 | Ga0102735_1000931 | 3300007080 | Bacteria | 11325 |
| 34 | Ga0103268_1003093 | 3300007192 | Unclassified | 3529 |
| 35 | Ga0103268_1007997 | 3300007192 | Unclassified | 2169 |
| 36 | Ga0466734_103526 | 3300042623 | Unclassified | 87559 |
| 37 | Ga0466709_176623 | 3300042648 | Bacteria | 13102 |
| 38 | Ga0466724_20015 | 3300042649 | Bacteria | 29012 |
| 39 | Ga0466724_41146 | 3300042649 | Bacteria | 3839 |
| 40 | Ga0466725_217245 | 3300042654 | Bacteria | 116780 |
| 41 | Ga0466722_019854 | 3300042609 | Bacteria | 25103 |
| 42 | Ga0466722_250031 | 3300042609 | Bacteria | 10289 |
| 43 | Ga0466710_012739 | 3300042613 | Bacteria | 2925 |
| 44 | Ga0466710_193824 | 3300042613 | Bacteria | 4506 |
| 45 | Ga0466710_344501 | 3300042613 | Bacteria | 3127 |
| 46 | Ga0466726_174933 | 3300042619 | Bacteria | 5109 |
| 47 | Ga0466729_009085 | 3300042621 | Bacteria | 86734 |
| 48 | Ga0160453_103729 | 3300012814 | Bacteria | 3040 |
| 49 | Ga0160446_101177 | 3300012835 | Bacteria | 6181 |
| 50 | Ga0466691_145191 | 3300042593 | Bacteria | 35878 |
| 51 | Ga0466701_006315 | 3300042598 | Bacteria | 28865 |
| 52 | JGI24702J35022_10001759 | 3300002462 | Unclassified | 13388 |
| 53 | Ga0102740_1000725 | 3300007140 | Unclassified | 8905 |
| 54 | Ga0103268_1000129 | 3300007192 | Bacteria | 25129 |
| 55 | Ga0123357_10142762 | 3300009784 | Bacteria | 2936 |
| 56 | Ga0466734_036391 | 3300042623 | Bacteria | 6789 |
| 57 | Ga0466703_128512 | 3300042636 | Bacteria | 2439 |
| 58 | Ga0466704_177680 | 3300042643 | Unclassified | 3497 |
| 59 | Ga0466709_165617 | 3300042648 | Bacteria | 7035 |
| 60 | Ga0466708_090561 | 3300042652 | Bacteria | 4613 |
| 61 | Ga0466708_299152 | 3300042652 | Bacteria | 6716 |
| 62 | Ga0466725_122565 | 3300042654 | Bacteria | 38170 |
| 63 | Ga0466705_390971 | 3300042612 | Bacteria | 8950 |
| 64 | Ga0466710_141574 | 3300042613 | Bacteria | 12782 |
| 65 | Ga0466715_212649 | 3300042616 | Bacteria | 2972 |
| 66 | Ga0466723_122868 | 3300042618 | Bacteria | 41280 |
| 67 | Ga0466728_193336 | 3300042620 | Bacteria | 35687 |
| 68 | Ga0160441_103014 | 3300012825 | Bacteria | 3037 |
| 69 | Ga0160443_100581 | 3300012848 | Bacteria | 22093 |
| 70 | Ga0466657_392614 | 3300042582 | Bacteria | 3744 |
| 71 | Ga0466690_302727 | 3300042590 | Bacteria | 11261 |
| 72 | Ga0466693_066789 | 3300042592 | Unclassified | 4627 |
| 73 | JGI24696J40584_12958336 | 3300002834 | Bacteria | 4049 |
| 74 | CVPL005W_1000004 | 3300002934 | Bacteria | 96038 |
| 75 | Ga0102736_1000293 | 3300007052 | Unclassified | 10904 |
| 76 | Ga0103266_1000347 | 3300007067 | Bacteria | 10759 |
| 77 | Ga0102740_1001589 | 3300007140 | Bacteria | 5637 |
| 78 | Ga0123357_10000145 | 3300009784 | Bacteria | 62746 |
| 79 | Ga0466729_240997 | 3300042621 | Bacteria | 4394 |
| 80 | Ga0466729_298505 | 3300042621 | Bacteria | 4080 |
| 81 | Ga0466734_010332 | 3300042623 | Bacteria | 8423 |
| 82 | Ga0466734_027083 | 3300042623 | Bacteria | 27139 |
| 83 | Ga0466704_475317 | 3300042643 | Bacteria | 3737 |
| 84 | Ga0466724_42315 | 3300042649 | Bacteria | 27702 |
| 85 | Ga0466708_202397 | 3300042652 | Bacteria | 3502 |
| 86 | Ga0466708_245958 | 3300042652 | Bacteria | 14733 |
| 87 | Ga0466725_015464 | 3300042654 | Bacteria | 3071 |
| 88 | Ga0466701_038375 | 3300042598 | Bacteria | 7928 |
| 89 | Ga0466701_081455 | 3300042598 | Bacteria | 3006 |
| 90 | Ga0466706_022654 | 3300042599 | Bacteria | 1115 |
| 91 | Ga0466717_035185 | 3300042604 | Bacteria | 11965 |
| 92 | Ga0466716_031816 | 3300042605 | Bacteria | 12096 |
| 93 | Ga0466716_404150 | 3300042605 | Bacteria | 1823 |
| 94 | Ga0466697_212791 | 3300042611 | Bacteria | 3120 |
| 95 | Ga0466726_325867 | 3300042619 | Bacteria | 2210 |
| 96 | Ga0160469_100092 | 3300012824 | Bacteria | 141191 |
| 97 | Ga0160460_101244 | 3300012845 | Bacteria | 9425 |
| 98 | Ga0160443_102409 | 3300012848 | Bacteria | 4181 |
| 99 | Ga0466692_053051 | 3300042591 | Bacteria | 75912 |
| 100 | Ga0466692_155145 | 3300042591 | Bacteria | 9851 |
| 101 | Ga0466693_131352 | 3300042592 | Bacteria | 3732 |
| 102 | Ga0466691_021711 | 3300042593 | Bacteria | 2674 |
| 103 | Ga0466695_122802 | 3300042595 | Bacteria | 3462 |
| 104 | SCG598O11_12230 | 3300000471 | Bacteria | 107509 |
| 105 | CVPL010W_10023373 | 3300002931 | Bacteria | 3183 |
| 106 | Ga0074278_119907 | 3300005721 | Unclassified | 5942 |
| 107 | Ga0102734_1003757 | 3300007129 | Bacteria | 3430 |
| 108 | Ga0123354_10000002 | 3300010882 | Bacteria | 317342 |
| 109 | Ga0123354_10017332 | 3300010882 | Bacteria | 11285 |
| 110 | Ga0160465_100516 | 3300012803 | Bacteria | 17941 |
| 111 | Ga0466731_174932 | 3300042622 | Bacteria | 22214 |
| 112 | Ga0466734_015561 | 3300042623 | Bacteria | 14910 |
| 113 | Ga0466703_029997 | 3300042636 | Bacteria | 82848 |
| 114 | Ga0466704_227726 | 3300042643 | Bacteria | 3518 |
| 115 | Ga0466709_115525 | 3300042648 | Bacteria | 2486 |
| 116 | Ga0466708_089791 | 3300042652 | Bacteria | 9698 |
| 117 | Ga0466707_417031 | 3300042601 | Bacteria | 8395 |
| 118 | Ga0466717_143422 | 3300042604 | Bacteria | 6646 |
| 119 | Ga0466719_354091 | 3300042606 | Bacteria | 9102 |
| 120 | Ga0466722_027152 | 3300042609 | Bacteria | 2288 |
| 121 | Ga0466722_073391 | 3300042609 | Bacteria | 14918 |
| 122 | Ga0466705_118839 | 3300042612 | Unclassified | 2173 |
| 123 | Ga0466705_223426 | 3300042612 | Bacteria | 6597 |
| 124 | Ga0466710_032489 | 3300042613 | Bacteria | 5795 |
| 125 | Ga0466710_142729 | 3300042613 | Bacteria | 3231 |
| 126 | Ga0466710_403779 | 3300042613 | Bacteria | 4462 |
| 127 | Ga0466710_440864 | 3300042613 | Bacteria | 58797 |
| 128 | Ga0466715_004687 | 3300042616 | Bacteria | 37637 |
| 129 | Ga0466715_287349 | 3300042616 | Bacteria | 86058 |
| 130 | Ga0160470_101460 | 3300012813 | Unclassified | 5644 |
| 131 | Ga0160446_100326 | 3300012835 | Bacteria | 26714 |
| 132 | Ga0160435_1007659 | 3300012857 | Bacteria | 2350 |
| 133 | Ga0103264_1000613 | 3300007188 | Bacteria | 17429 |
| 134 | Ga0123357_10000010 | 3300009784 | Bacteria | 190233 |
| 135 | Ga0123357_10198281 | 3300009784 | Bacteria | 2292 |
| 136 | Ga0123357_10214750 | 3300009784 | Bacteria | 2150 |
| 137 | Ga0160442_101675 | 3300012806 | Bacteria | 2603 |
| 138 | Ga0466729_237503 | 3300042621 | Bacteria | 3280 |
| 139 | Ga0466731_430937 | 3300042622 | Bacteria | 4546 |
| 140 | Ga0466730_060188 | 3300042625 | Bacteria | 807184 |
| 141 | Ga0466719_500468 | 3300042606 | Bacteria | 8114 |
| 142 | Ga0466722_167486 | 3300042609 | Bacteria | 5720 |
| 143 | Ga0466697_014696 | 3300042611 | Bacteria | 9809 |
| 144 | Ga0466710_305379 | 3300042613 | Bacteria | 1385 |
| 145 | Ga0466711_162102 | 3300042615 | Bacteria | 39241 |
| 146 | Ga0466715_543850 | 3300042616 | Bacteria | 3167 |
| 147 | Ga0466723_070255 | 3300042618 | Bacteria | 28764 |
| 148 | Ga0466726_062783 | 3300042619 | Bacteria | 4240 |
| 149 | Ga0466726_213038 | 3300042619 | Bacteria | 6400 |
| 150 | Ga0160472_102329 | 3300012839 | Bacteria | 4395 |
| 151 | Ga0160444_100288 | 3300012841 | Bacteria | 36938 |
| 152 | Ga0466690_042353 | 3300042590 | Bacteria | 19415 |
| 153 | DPO_contig09127 | 2032320009 | Bacteria | 31539 |
| 154 | SPBB_contig11539 | 2044078006 | Bacteria | 54533 |
| 155 | HBC_ctgsDRAFT_1006521 | 3300000333 | Bacteria | 2735 |
| 156 | Ga0074306_1118468 | 3300005309 | Bacteria | 1748 |
| 157 | Ga0102737_1001259 | 3300007142 | Bacteria | 7242 |
| 158 | Ga0123356_10358103 | 3300010049 | Bacteria | 1585 |
| 159 | Ga0466734_127597 | 3300042623 | Bacteria | 2574 |
| 160 | Ga0466704_246768 | 3300042643 | Bacteria | 3222 |
| 161 | Ga0466708_288440 | 3300042652 | Bacteria | 29694 |
| 162 | Ga0466708_340846 | 3300042652 | Bacteria | 3750 |
| 163 | Ga0466701_025648 | 3300042598 | Bacteria | 30684 |
| 164 | Ga0466701_054033 | 3300042598 | Bacteria | 1235 |
| 165 | Ga0466707_047443 | 3300042601 | Bacteria | 10564 |
| 166 | Ga0466707_047534 | 3300042601 | Bacteria | 10524 |
| 167 | Ga0466707_155654 | 3300042601 | Bacteria | 3655 |
| 168 | Ga0466719_187263 | 3300042606 | Bacteria | 6990 |
| 169 | Ga0466719_275615 | 3300042606 | Bacteria | 14221 |
| 170 | Ga0466705_420320 | 3300042612 | Bacteria | 1589 |
| 171 | Ga0466710_033940 | 3300042613 | Bacteria | 4310 |
| 172 | Ga0466712_034997 | 3300042614 | Bacteria | 22735 |
| 173 | Ga0466723_334416 | 3300042618 | Bacteria | 7260 |
| 174 | Ga0466726_263021 | 3300042619 | Bacteria | 2652 |
| 175 | Ga0160453_103473 | 3300012814 | Bacteria | 3247 |
| 176 | Ga0160432_100600 | 3300012818 | Bacteria | 20342 |
| 177 | Ga0466657_175551 | 3300042582 | Bacteria | 13640 |
| 178 | Ga0466657_184491 | 3300042582 | Bacteria | 28944 |
| 179 | Ga0466693_055530 | 3300042592 | Bacteria | 5102 |
| 180 | Ga0466693_243237 | 3300042592 | Bacteria | 4416 |
| 181 | Ga0466691_097424 | 3300042593 | Bacteria | 8737 |
| 182 | SCG598J21_11558 | 3300000475 | Bacteria | 18284 |
| 183 | CVPL005W_1000472 | 3300002934 | Bacteria | 15936 |
| 184 | Ga0074278_133824 | 3300005721 | Bacteria | 12386 |
| 185 | Ga0103265_1000633 | 3300007068 | Bacteria | 5926 |
| 186 | Ga0123353_10000043 | 3300010167 | Bacteria | 135610 |
| 187 | Ga0123353_10372112 | 3300010167 | Bacteria | 2141 |
| 188 | Ga0466734_157789 | 3300042623 | Bacteria | 4199 |
| 189 | Ga0466703_425473 | 3300042636 | Bacteria | 16451 |
| 190 | Ga0466704_099496 | 3300042643 | Bacteria | 2425 |
| 191 | Ga0466724_29472 | 3300042649 | Bacteria | 417400 |
| 192 | Ga0466708_116129 | 3300042652 | Bacteria | 3795 |
| 193 | Ga0466701_087199 | 3300042598 | Bacteria | 101525 |
| 194 | Ga0466707_157318 | 3300042601 | Bacteria | 3572 |
| 195 | Ga0466713_090939 | 3300042602 | Bacteria | 17433 |
| 196 | Ga0466719_223584 | 3300042606 | Bacteria | 1322 |
| 197 | Ga0466721_293585 | 3300042608 | Bacteria | 4142 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00482 | T2SSF | Type II secretion system (T2SS), protein F | 86 | 209 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.