Protein Family IF06686

Metagenome Isolate
148 Members
53 Samples
142 Scaffolds
273.02 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_224918|Ga0466720_224918_1461_2357
Length
298 aa
Sequence
MASLKRVIVSALRSRSIYTAAHAAHKKVNRRWGAHIILIIWSLIVLFPLWIMLINSFKDRLSIYQNPFGLPQKWNFINYGAVFTNGDFLVYFKNSFVVVILSLALMLTVSSLAAYALVNWRGKISRGLYFFFIAGMMLPIKIASIRILELVRFLGLINTIWSLVPVYTAMGIPVALFILTGFIREIPYELTEAGIIDGAGRFIIFTRIIAPLLRPALATTAIYNLVPFWNDLWFPLIFIADDRAKTLLLGVTRLFGQYQTDWSRVLAVLTLSAIPVIFLYLLMSKQFIKGLTAGAVKG

📊 Sample Types

Isolate 4.0%
Metagenome 96.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.1%
Kalotermitidae 23.1%
Unclassified 13.5%
Termopsidae 7.7%
Rhinotermitidae 5.8%
Blaberidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190975 Treponema sp. RmG30 Isolate Blaberidae
2 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
3 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
4 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
5 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
8 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
9 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
20 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
27 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
32 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
36 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
42 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
49 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
50 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
51 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
52 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
53 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_172430 3300042656 Unclassified 2743
2 Ga0466732_186343 3300042656 Bacteria 1508
3 Ga0466733_150287 3300042659 Bacteria 12115
4 Ga0466712_237071 3300042614 Bacteria 2216
5 Ga0466711_021704 3300042615 Bacteria 6171
6 Ga0466718_057919 3300042617 Unclassified 2170
7 Ga0466726_407357 3300042619 Bacteria 4801
8 Ga0466707_124937 3300042601 Bacteria 5094
9 Ga0466719_516068 3300042606 Bacteria 1678
10 Ga0466722_019228 3300042609 Bacteria 2496
11 Ga0466698_257566 3300042610 Unclassified 7917
12 Ga0466696_113981 3300042596 Bacteria 12936
13 Ga0466696_355841 3300042596 Bacteria 26852
14 Ga0123356_10621125 3300010049 Bacteria 1246
15 Ga0123354_10287637 3300010882 Bacteria 1582
16 Ga0466735_019868 3300042624 Bacteria 4677
17 Ga0466703_224035 3300042636 Unclassified 5659
18 Ga0466708_383745 3300042652 Bacteria 2463
19 AustNasuHG_c1004370 3300000089 Bacteria 5070
20 JGI24698J34947_10002394 3300002449 Bacteria 10095
21 JGI24695J34938_10004451 3300002450 Bacteria 9175
22 JGI24702J35022_10092500 3300002462 Bacteria 1647
23 Ga0466732_036891 3300042656 Bacteria 25406
24 Ga0466712_193587 3300042614 Bacteria 5991
25 Ga0456237_0001404 3300041968 Bacteria 3833
26 Ga0466691_060681 3300042593 Bacteria 18076
27 Ga0123357_10096980 3300009784 Bacteria 3816
28 Ga0123353_10021687 3300010167 Bacteria 9649
29 Ga0123353_10455610 3300010167 Bacteria 1882
30 Ga0466704_110697 3300042643 Bacteria 1106
31 Ga0466708_139430 3300042652 Bacteria 31102
32 Ga0466727_173603 3300042655 Bacteria 10717
33 JGI24698J34947_10078012 3300002449 Unclassified 1564
34 JGI24705J35276_12133589 3300002504 Bacteria 1113
35 Ga0466733_004126 3300042659 Bacteria 3245
36 Ga0466712_077031 3300042614 Bacteria 5736
37 Ga0466712_210197 3300042614 Unclassified 1789
38 Ga0466711_517498 3300042615 Bacteria 14845
39 Ga0466718_090449 3300042617 Unclassified 1161
40 Ga0466726_464550 3300042619 Bacteria 5405
41 Ga0466719_023416 3300042606 Bacteria 7955
42 Ga0466722_066215 3300042609 Bacteria 4685
43 Ga0466722_142246 3300042609 Bacteria 7156
44 Ga0466692_045618 3300042591 Bacteria 2973
45 Ga0466696_060405 3300042596 Bacteria 4531
46 Ga0123353_10222334 3300010167 Bacteria 2951
47 Ga0123354_10407091 3300010882 Bacteria 1145
48 Ga0466703_061593 3300042636 Bacteria 16078
49 JGI24695J34938_10007362 3300002450 Bacteria 6454
50 JGI24705J35276_12173932 3300002504 Bacteria 1313
51 Ga0466732_195229 3300042656 Bacteria 2004
52 Ga0466732_310078 3300042656 Bacteria 3385
53 Ga0466712_095563 3300042614 Bacteria 1418
54 Ga0466718_159975 3300042617 Bacteria 2350
55 Ga0466726_317950 3300042619 Bacteria 2165
56 Ga0466720_141787 3300042607 Bacteria 4519
57 Ga0466720_224918 3300042607 Bacteria 3881
58 Ga0466694_234808 3300042594 Bacteria 2539
59 Ga0466694_385720 3300042594 Bacteria 1808
60 Ga0466699_436518 3300042597 Bacteria 1076
61 Ga0466704_036073 3300042643 Unclassified 1438
62 Ga0466708_394409 3300042652 Bacteria 11863
63 JGI24698J34947_10017122 3300002449 Bacteria 3931
64 JGI24705J35276_12219803 3300002504 Bacteria 2227
65 Ga0466705_060804 3300042612 Bacteria 2867
66 Ga0466732_029119 3300042656 Bacteria 1205
67 Ga0466732_192036 3300042656 Bacteria 4897
68 Ga0466718_163443 3300042617 Bacteria 1908
69 Ga0466726_050722 3300042619 Bacteria 27933
70 Ga0466728_138342 3300042620 Bacteria 3096
71 Ga0466722_220246 3300042609 Bacteria 3440
72 Ga0466692_047928 3300042591 Bacteria 29037
73 Ga0466694_112875 3300042594 Bacteria 3487
74 Ga0466699_021017 3300042597 Bacteria 4766
75 Ga0466699_072196 3300042597 Bacteria 50938
76 Ga0123355_10559350 3300009826 Bacteria 1379
77 Ga0123353_10387401 3300010167 Bacteria 2087
78 AustNasuHG_c1003161 3300000089 Bacteria 5939
79 JGI24702J35022_10004788 3300002462 Bacteria 7995
80 Ga0466718_111789 3300042617 Bacteria 6831
81 Ga0466726_066536 3300042619 Bacteria 4893
82 Ga0466719_359508 3300042606 Bacteria 2609
83 Ga0466720_144023 3300042607 Bacteria 21010
84 Ga0466722_008188 3300042609 Bacteria 6815
85 Ga0466698_168285 3300042610 Bacteria 4814
86 Ga0456237_0002720 3300041968 Bacteria 2857
87 Ga0466690_236481 3300042590 Bacteria 11186
88 Ga0466694_285595 3300042594 Bacteria 1406
89 Ga0466695_340113 3300042595 Bacteria 3662
90 Ga0466699_299905 3300042597 Bacteria 2248
91 Ga0466735_152216 3300042624 Bacteria 1215
92 Ga0466709_259288 3300042648 Bacteria 12163
93 Ga0466709_368115 3300042648 Bacteria 3806
94 Ga0466708_415237 3300042652 Bacteria 20285
95 AustNasuHG_c1007557 3300000089 Bacteria 3859
96 JGI24702J35022_10019359 3300002462 Bacteria 3702
97 JGI24705J35276_12184735 3300002504 Bacteria 1403
98 Ga0466732_121638 3300042656 Bacteria 5699
99 Ga0466733_001144 3300042659 Bacteria 4616
100 Ga0466733_028220 3300042659 Unclassified 5165
101 Ga0466711_096348 3300042615 Bacteria 13113
102 Ga0466726_061376 3300042619 Unclassified 2090
103 Ga0466728_375903 3300042620 Bacteria 11149
104 Ga0466714_118843 3300042603 Bacteria 1182
105 Ga0466717_182004 3300042604 Bacteria 1791
106 Ga0466720_023132 3300042607 Bacteria 6990
107 Ga0466720_115208 3300042607 Bacteria 9027
108 Ga0466698_201758 3300042610 Bacteria 1059
109 Ga0264413_126436 3300024493 Bacteria 2479
110 Ga0466693_152830 3300042592 Bacteria 52782
111 Ga0466694_332414 3300042594 Bacteria 2036
112 Ga0466699_413294 3300042597 Bacteria 25958
113 Ga0123357_10430678 3300009784 Bacteria 1166
114 Ga0123356_10001575 3300010049 Bacteria 25090
115 Ga0123356_10017091 3300010049 Bacteria 6904
116 Ga0123356_10048311 3300010049 Bacteria 3960
117 Ga0123356_10795830 3300010049 Bacteria 1116
118 Ga0466704_051666 3300042643 Bacteria 7449
119 Ga0466709_067608 3300042648 Bacteria 24200
120 AustNasuHG_c1038896 3300000089 Bacteria 1190
121 JGI24698J34947_10053618 3300002449 Bacteria 2017
122 Ga0068305_10061278 3300005083 Bacteria 11222
123 Ga0466732_235041 3300042656 Unclassified 1665
124 Ga0466733_141420 3300042659 Bacteria 62681
125 Ga0466712_172065 3300042614 Unclassified 3352
126 Ga0466718_131236 3300042617 Bacteria 16931
127 Ga0466726_089705 3300042619 Bacteria 1841
128 Ga0466707_168163 3300042601 Bacteria 1379
129 Ga0466716_102525 3300042605 Bacteria 18805
130 Ga0466722_095351 3300042609 Bacteria 10158
131 Ga0466722_125296 3300042609 Bacteria 8261
132 Ga0466695_315985 3300042595 Bacteria 38906
133 Ga0466699_013531 3300042597 Bacteria 1021
134 Ga0466699_127032 3300042597 Unclassified 1079
135 Ga0123356_10013061 3300010049 Bacteria 8035
136 Ga0123356_10013697 3300010049 Bacteria 7813
137 Ga0466730_022153 3300042625 Bacteria 1654
138 Ga0466702_423106 3300042635 Bacteria 1768
139 JGI24702J35022_10047458 3300002462 Bacteria 2286
140 JGI24702J35022_10053470 3300002462 Bacteria 2154
141 JGI24697J35500_11274393 3300002507 Bacteria 7192
142 Ga0068302_10235442 3300005071 Unclassified 1914

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300041968 Ga0456237_0001404 Ga0456237_0001404_411_1154 247
2 3300042594 Ga0466694_234808 Ga0466694_234808_1255_1998 247
3 3300042596 Ga0466696_113981 Ga0466696_113981_1123_1866 247
4 3300042597 Ga0466699_013531 Ga0466699_013531_152_895 247
5 3300042597 Ga0466699_127032 Ga0466699_127032_78_821 247
6 3300042597 Ga0466699_436518 Ga0466699_436518_36_779 247
7 3300042607 Ga0466720_115208 Ga0466720_115208_7945_8688 247
8 3300042614 Ga0466712_237071 Ga0466712_237071_1119_1862 247
9 3300042617 Ga0466718_057919 Ga0466718_057919_376_1119 247
10 3300042617 Ga0466718_090449 Ga0466718_090449_356_1099 247
11 3300042617 Ga0466718_111789 Ga0466718_111789_4929_5672 247
12 3300042617 Ga0466718_159975 Ga0466718_159975_495_1238 247
13 3300042619 Ga0466726_061376 Ga0466726_061376_19_762 247
14 3300042619 Ga0466726_089705 Ga0466726_089705_82_825 247
15 3300042619 Ga0466726_464550 Ga0466726_464550_2177_2920 247
16 3300042624 Ga0466735_019868 Ga0466735_019868_1064_1807 247
17 3300042636 Ga0466703_224035 Ga0466703_224035_4836_5579 247
18 3300042652 Ga0466708_383745 Ga0466708_383745_30_773 247
19 3300042656 Ga0466732_235041 Ga0466732_235041_74_817 247
20 3300010049 Ga0123356_10795830 Ga0123356_107958302 248
21 3300042659 Ga0466733_001144 Ga0466733_001144_1858_2610 250
22 3300042656 Ga0466732_192036 Ga0466732_192036_2811_3653 257
23 3300010049 Ga0123356_10017091 Ga0123356_100170913 263
24 3300010049 Ga0123356_10048311 Ga0123356_100483113 263
25 3300042619 Ga0466726_066536 Ga0466726_066536_2314_3147 263
26 3300000089 AustNasuHG_c1007557 AustNasuHG_10075574 264
27 3300005071 Ga0068302_10235442 Ga0068302_102354421 265
28 3300042596 Ga0466696_060405 Ga0466696_060405_2848_3687 266
29 3300042652 Ga0466708_139430 Ga0466708_139430_13445_14284 266
30 3300010049 Ga0123356_10013697 Ga0123356_100136972 268
31 3300042607 Ga0466720_141787 Ga0466720_141787_1154_1990 268
32 3300042655 Ga0466727_173603 Ga0466727_173603_8152_8997 268
33 3300042594 Ga0466694_332414 Ga0466694_332414_280_1089 269
34 3300042607 Ga0466720_144023 Ga0466720_144023_14493_15302 269
35 3300002462 JGI24702J35022_10092500 JGI24702J35022_100925002 270
36 3300010049 Ga0123356_10621125 Ga0123356_106211252 270
37 3300041968 Ga0456237_0002720 Ga0456237_0002720_1132_1974 270
38 3300042615 Ga0466711_021704 Ga0466711_021704_679_1518 272
39 3300010049 Ga0123356_10001575 Ga0123356_100015757 276
40 3300024493 Ga0264413_126436 Ga0264413_1264363 277
41 3300042591 Ga0466692_045618 Ga0466692_045618_2039_2872 277
42 3300042594 Ga0466694_112875 Ga0466694_112875_2486_3319 277
43 3300042594 Ga0466694_285595 Ga0466694_285595_255_1088 277
44 3300042594 Ga0466694_385720 Ga0466694_385720_815_1648 277
45 3300042597 Ga0466699_021017 Ga0466699_021017_346_1179 277
46 3300042597 Ga0466699_072196 Ga0466699_072196_38912_39745 277
47 3300042597 Ga0466699_299905 Ga0466699_299905_27_860 277
48 3300042597 Ga0466699_413294 Ga0466699_413294_24067_24900 277
49 3300042603 Ga0466714_118843 Ga0466714_118843_237_1070 277
50 3300042604 Ga0466717_182004 Ga0466717_182004_231_1064 277
51 3300042607 Ga0466720_023132 Ga0466720_023132_4116_4949 277
52 3300042609 Ga0466722_008188 Ga0466722_008188_2609_3442 277
53 3300042609 Ga0466722_019228 Ga0466722_019228_1157_1990 277
54 3300042609 Ga0466722_066215 Ga0466722_066215_1007_1840 277
55 3300042609 Ga0466722_125296 Ga0466722_125296_1523_2356 277
56 3300042609 Ga0466722_142246 Ga0466722_142246_614_1447 277
57 3300042609 Ga0466722_220246 Ga0466722_220246_727_1560 277
58 3300042610 Ga0466698_168285 Ga0466698_168285_2865_3698 277
59 3300042610 Ga0466698_201758 Ga0466698_201758_156_989 277
60 3300042614 Ga0466712_077031 Ga0466712_077031_3026_3859 277
61 3300042614 Ga0466712_095563 Ga0466712_095563_551_1384 277
62 3300042614 Ga0466712_172065 Ga0466712_172065_1953_2786 277
63 3300042614 Ga0466712_193587 Ga0466712_193587_1185_2018 277
64 3300042614 Ga0466712_210197 Ga0466712_210197_295_1128 277
65 3300042617 Ga0466718_131236 Ga0466718_131236_5482_6315 277
66 3300042617 Ga0466718_163443 Ga0466718_163443_47_880 277
67 3300042625 Ga0466730_022153 Ga0466730_022153_750_1583 277
68 3300042635 Ga0466702_423106 Ga0466702_423106_316_1149 277
69 3300042656 Ga0466732_029119 Ga0466732_029119_254_1087 277
70 3300042656 Ga0466732_121638 Ga0466732_121638_1423_2256 277
71 3300042656 Ga0466732_310078 Ga0466732_310078_1130_1963 277
72 iso_pr_bacteria 2781125651 2781310100 277
73 iso_pr_bacteria 2781125691 2781428934 277
74 iso_pr_bacteria 2781125692 2781430751 277
75 3300000089 AustNasuHG_c1038896 AustNasuHG_10388962 278
76 3300002449 JGI24698J34947_10053618 JGI24698J34947_100536183 278
77 3300002449 JGI24698J34947_10078012 JGI24698J34947_100780122 278
78 3300002450 JGI24695J34938_10007362 JGI24695J34938_100073622 278
79 3300002462 JGI24702J35022_10004788 JGI24702J35022_100047883 278
80 3300002462 JGI24702J35022_10019359 JGI24702J35022_100193596 278
81 3300002462 JGI24702J35022_10053470 JGI24702J35022_100534702 278
82 3300002504 JGI24705J35276_12133589 JGI24705J35276_121335892 278
83 3300002504 JGI24705J35276_12173932 JGI24705J35276_121739321 278
84 3300002504 JGI24705J35276_12184735 JGI24705J35276_121847352 278
85 3300002504 JGI24705J35276_12219803 JGI24705J35276_122198032 278
86 3300002507 JGI24697J35500_11274393 JGI24697J35500_112743932 278
87 3300009784 Ga0123357_10096980 Ga0123357_100969802 278
88 3300009784 Ga0123357_10430678 Ga0123357_104306781 278
89 3300010167 Ga0123353_10021687 Ga0123353_100216874 278
90 3300010167 Ga0123353_10387401 Ga0123353_103874012 278
91 3300010882 Ga0123354_10287637 Ga0123354_102876372 278
92 3300042615 Ga0466711_517498 Ga0466711_517498_9152_9988 278
93 3300042624 Ga0466735_152216 Ga0466735_152216_105_941 278
94 3300000089 AustNasuHG_c1004370 AustNasuHG_10043704 279
95 3300002449 JGI24698J34947_10002394 JGI24698J34947_100023943 279
96 3300002462 JGI24702J35022_10047458 JGI24702J35022_100474582 279
97 3300009826 Ga0123355_10559350 Ga0123355_105593501 279
98 3300010882 Ga0123354_10407091 Ga0123354_104070911 279
99 3300042590 Ga0466690_236481 Ga0466690_236481_10006_10845 279
100 3300042591 Ga0466692_047928 Ga0466692_047928_23232_24071 279
101 3300042593 Ga0466691_060681 Ga0466691_060681_7450_8289 279
102 3300042596 Ga0466696_355841 Ga0466696_355841_4413_5252 279
103 3300042601 Ga0466707_124937 Ga0466707_124937_556_1395 279
104 3300042605 Ga0466716_102525 Ga0466716_102525_6011_6850 279
105 3300042606 Ga0466719_023416 Ga0466719_023416_6761_7600 279
106 3300042606 Ga0466719_359508 Ga0466719_359508_1280_2119 279
107 3300042606 Ga0466719_516068 Ga0466719_516068_301_1140 279
108 3300042609 Ga0466722_095351 Ga0466722_095351_5569_6408 279
109 3300042610 Ga0466698_257566 Ga0466698_257566_1044_1883 279
110 3300042612 Ga0466705_060804 Ga0466705_060804_513_1352 279
111 3300042615 Ga0466711_096348 Ga0466711_096348_2475_3314 279
112 3300042619 Ga0466726_050722 Ga0466726_050722_25745_26584 279
113 3300042619 Ga0466726_407357 Ga0466726_407357_1498_2337 279
114 3300042620 Ga0466728_138342 Ga0466728_138342_332_1171 279
115 3300042620 Ga0466728_375903 Ga0466728_375903_5843_6682 279
116 3300042636 Ga0466703_061593 Ga0466703_061593_12550_13389 279
117 3300042643 Ga0466704_036073 Ga0466704_036073_100_939 279
118 3300042643 Ga0466704_051666 Ga0466704_051666_1288_2127 279
119 3300042643 Ga0466704_110697 Ga0466704_110697_100_939 279
120 3300042648 Ga0466709_067608 Ga0466709_067608_3148_3987 279
121 3300042648 Ga0466709_259288 Ga0466709_259288_2437_3276 279
122 3300042652 Ga0466708_394409 Ga0466708_394409_6498_7337 279
123 3300042652 Ga0466708_415237 Ga0466708_415237_4203_5042 279
124 3300042656 Ga0466732_036891 Ga0466732_036891_3505_4344 279
125 3300042656 Ga0466732_186343 Ga0466732_186343_149_988 279
126 iso_pr_bacteria 650716099 650879286 279
127 3300005083 Ga0068305_10061278 Ga0068305_100612784 280
128 3300010167 Ga0123353_10222334 Ga0123353_102223342 280
129 3300010167 Ga0123353_10455610 Ga0123353_104556102 280
130 3300042595 Ga0466695_340113 Ga0466695_340113_1633_2475 280
131 3300042619 Ga0466726_317950 Ga0466726_317950_64_906 280
132 3300042648 Ga0466709_368115 Ga0466709_368115_451_1293 280
133 iso_pr_bacteria 2772190975 2773723965 280
134 3300042659 Ga0466733_004126 Ga0466733_004126_1004_1849 281
135 3300042659 Ga0466733_028220 Ga0466733_028220_2269_3114 281
136 3300042659 Ga0466733_141420 Ga0466733_141420_56510_57355 281
137 3300042659 Ga0466733_150287 Ga0466733_150287_4588_5433 281
138 3300010049 Ga0123356_10013061 Ga0123356_100130617 282
139 3300042595 Ga0466695_315985 Ga0466695_315985_35086_35934 282
140 3300000089 AustNasuHG_c1003161 AustNasuHG_10031612 283
141 3300042592 Ga0466693_152830 Ga0466693_152830_29788_30639 283
142 3300002449 JGI24698J34947_10017122 JGI24698J34947_100171223 284
143 3300002450 JGI24695J34938_10004451 JGI24695J34938_100044514 284
144 3300042601 Ga0466707_168163 Ga0466707_168163_60_917 285
145 3300042656 Ga0466732_172430 Ga0466732_172430_449_1309 286
146 3300042656 Ga0466732_195229 Ga0466732_195229_782_1642 286
147 iso_pr_bacteria 2781125661 2781333614 288
148 3300042607 Ga0466720_224918 Ga0466720_224918_1461_2357 298

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 108 283 0.79

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.62 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.