Protein Family IF06686
Metagenome
Isolate
148
Members
53
Samples
142
Scaffolds
273.02
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_224918|Ga0466720_224918_1461_2357
- Length
- 298 aa
- Sequence
- MASLKRVIVSALRSRSIYTAAHAAHKKVNRRWGAHIILIIWSLIVLFPLWIMLINSFKDRLSIYQNPFGLPQKWNFINYGAVFTNGDFLVYFKNSFVVVILSLALMLTVSSLAAYALVNWRGKISRGLYFFFIAGMMLPIKIASIRILELVRFLGLINTIWSLVPVYTAMGIPVALFILTGFIREIPYELTEAGIIDGAGRFIIFTRIIAPLLRPALATTAIYNLVPFWNDLWFPLIFIADDRAKTLLLGVTRLFGQYQTDWSRVLAVLTLSAIPVIFLYLLMSKQFIKGLTAGAVKG
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.1%
Kalotermitidae
23.1%
Unclassified
13.5%
Termopsidae
7.7%
Rhinotermitidae
5.8%
Blaberidae
1.9%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 2 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 3 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 6 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 36 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 42 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 49 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_172430 | 3300042656 | Unclassified | 2743 |
| 2 | Ga0466732_186343 | 3300042656 | Bacteria | 1508 |
| 3 | Ga0466733_150287 | 3300042659 | Bacteria | 12115 |
| 4 | Ga0466712_237071 | 3300042614 | Bacteria | 2216 |
| 5 | Ga0466711_021704 | 3300042615 | Bacteria | 6171 |
| 6 | Ga0466718_057919 | 3300042617 | Unclassified | 2170 |
| 7 | Ga0466726_407357 | 3300042619 | Bacteria | 4801 |
| 8 | Ga0466707_124937 | 3300042601 | Bacteria | 5094 |
| 9 | Ga0466719_516068 | 3300042606 | Bacteria | 1678 |
| 10 | Ga0466722_019228 | 3300042609 | Bacteria | 2496 |
| 11 | Ga0466698_257566 | 3300042610 | Unclassified | 7917 |
| 12 | Ga0466696_113981 | 3300042596 | Bacteria | 12936 |
| 13 | Ga0466696_355841 | 3300042596 | Bacteria | 26852 |
| 14 | Ga0123356_10621125 | 3300010049 | Bacteria | 1246 |
| 15 | Ga0123354_10287637 | 3300010882 | Bacteria | 1582 |
| 16 | Ga0466735_019868 | 3300042624 | Bacteria | 4677 |
| 17 | Ga0466703_224035 | 3300042636 | Unclassified | 5659 |
| 18 | Ga0466708_383745 | 3300042652 | Bacteria | 2463 |
| 19 | AustNasuHG_c1004370 | 3300000089 | Bacteria | 5070 |
| 20 | JGI24698J34947_10002394 | 3300002449 | Bacteria | 10095 |
| 21 | JGI24695J34938_10004451 | 3300002450 | Bacteria | 9175 |
| 22 | JGI24702J35022_10092500 | 3300002462 | Bacteria | 1647 |
| 23 | Ga0466732_036891 | 3300042656 | Bacteria | 25406 |
| 24 | Ga0466712_193587 | 3300042614 | Bacteria | 5991 |
| 25 | Ga0456237_0001404 | 3300041968 | Bacteria | 3833 |
| 26 | Ga0466691_060681 | 3300042593 | Bacteria | 18076 |
| 27 | Ga0123357_10096980 | 3300009784 | Bacteria | 3816 |
| 28 | Ga0123353_10021687 | 3300010167 | Bacteria | 9649 |
| 29 | Ga0123353_10455610 | 3300010167 | Bacteria | 1882 |
| 30 | Ga0466704_110697 | 3300042643 | Bacteria | 1106 |
| 31 | Ga0466708_139430 | 3300042652 | Bacteria | 31102 |
| 32 | Ga0466727_173603 | 3300042655 | Bacteria | 10717 |
| 33 | JGI24698J34947_10078012 | 3300002449 | Unclassified | 1564 |
| 34 | JGI24705J35276_12133589 | 3300002504 | Bacteria | 1113 |
| 35 | Ga0466733_004126 | 3300042659 | Bacteria | 3245 |
| 36 | Ga0466712_077031 | 3300042614 | Bacteria | 5736 |
| 37 | Ga0466712_210197 | 3300042614 | Unclassified | 1789 |
| 38 | Ga0466711_517498 | 3300042615 | Bacteria | 14845 |
| 39 | Ga0466718_090449 | 3300042617 | Unclassified | 1161 |
| 40 | Ga0466726_464550 | 3300042619 | Bacteria | 5405 |
| 41 | Ga0466719_023416 | 3300042606 | Bacteria | 7955 |
| 42 | Ga0466722_066215 | 3300042609 | Bacteria | 4685 |
| 43 | Ga0466722_142246 | 3300042609 | Bacteria | 7156 |
| 44 | Ga0466692_045618 | 3300042591 | Bacteria | 2973 |
| 45 | Ga0466696_060405 | 3300042596 | Bacteria | 4531 |
| 46 | Ga0123353_10222334 | 3300010167 | Bacteria | 2951 |
| 47 | Ga0123354_10407091 | 3300010882 | Bacteria | 1145 |
| 48 | Ga0466703_061593 | 3300042636 | Bacteria | 16078 |
| 49 | JGI24695J34938_10007362 | 3300002450 | Bacteria | 6454 |
| 50 | JGI24705J35276_12173932 | 3300002504 | Bacteria | 1313 |
| 51 | Ga0466732_195229 | 3300042656 | Bacteria | 2004 |
| 52 | Ga0466732_310078 | 3300042656 | Bacteria | 3385 |
| 53 | Ga0466712_095563 | 3300042614 | Bacteria | 1418 |
| 54 | Ga0466718_159975 | 3300042617 | Bacteria | 2350 |
| 55 | Ga0466726_317950 | 3300042619 | Bacteria | 2165 |
| 56 | Ga0466720_141787 | 3300042607 | Bacteria | 4519 |
| 57 | Ga0466720_224918 | 3300042607 | Bacteria | 3881 |
| 58 | Ga0466694_234808 | 3300042594 | Bacteria | 2539 |
| 59 | Ga0466694_385720 | 3300042594 | Bacteria | 1808 |
| 60 | Ga0466699_436518 | 3300042597 | Bacteria | 1076 |
| 61 | Ga0466704_036073 | 3300042643 | Unclassified | 1438 |
| 62 | Ga0466708_394409 | 3300042652 | Bacteria | 11863 |
| 63 | JGI24698J34947_10017122 | 3300002449 | Bacteria | 3931 |
| 64 | JGI24705J35276_12219803 | 3300002504 | Bacteria | 2227 |
| 65 | Ga0466705_060804 | 3300042612 | Bacteria | 2867 |
| 66 | Ga0466732_029119 | 3300042656 | Bacteria | 1205 |
| 67 | Ga0466732_192036 | 3300042656 | Bacteria | 4897 |
| 68 | Ga0466718_163443 | 3300042617 | Bacteria | 1908 |
| 69 | Ga0466726_050722 | 3300042619 | Bacteria | 27933 |
| 70 | Ga0466728_138342 | 3300042620 | Bacteria | 3096 |
| 71 | Ga0466722_220246 | 3300042609 | Bacteria | 3440 |
| 72 | Ga0466692_047928 | 3300042591 | Bacteria | 29037 |
| 73 | Ga0466694_112875 | 3300042594 | Bacteria | 3487 |
| 74 | Ga0466699_021017 | 3300042597 | Bacteria | 4766 |
| 75 | Ga0466699_072196 | 3300042597 | Bacteria | 50938 |
| 76 | Ga0123355_10559350 | 3300009826 | Bacteria | 1379 |
| 77 | Ga0123353_10387401 | 3300010167 | Bacteria | 2087 |
| 78 | AustNasuHG_c1003161 | 3300000089 | Bacteria | 5939 |
| 79 | JGI24702J35022_10004788 | 3300002462 | Bacteria | 7995 |
| 80 | Ga0466718_111789 | 3300042617 | Bacteria | 6831 |
| 81 | Ga0466726_066536 | 3300042619 | Bacteria | 4893 |
| 82 | Ga0466719_359508 | 3300042606 | Bacteria | 2609 |
| 83 | Ga0466720_144023 | 3300042607 | Bacteria | 21010 |
| 84 | Ga0466722_008188 | 3300042609 | Bacteria | 6815 |
| 85 | Ga0466698_168285 | 3300042610 | Bacteria | 4814 |
| 86 | Ga0456237_0002720 | 3300041968 | Bacteria | 2857 |
| 87 | Ga0466690_236481 | 3300042590 | Bacteria | 11186 |
| 88 | Ga0466694_285595 | 3300042594 | Bacteria | 1406 |
| 89 | Ga0466695_340113 | 3300042595 | Bacteria | 3662 |
| 90 | Ga0466699_299905 | 3300042597 | Bacteria | 2248 |
| 91 | Ga0466735_152216 | 3300042624 | Bacteria | 1215 |
| 92 | Ga0466709_259288 | 3300042648 | Bacteria | 12163 |
| 93 | Ga0466709_368115 | 3300042648 | Bacteria | 3806 |
| 94 | Ga0466708_415237 | 3300042652 | Bacteria | 20285 |
| 95 | AustNasuHG_c1007557 | 3300000089 | Bacteria | 3859 |
| 96 | JGI24702J35022_10019359 | 3300002462 | Bacteria | 3702 |
| 97 | JGI24705J35276_12184735 | 3300002504 | Bacteria | 1403 |
| 98 | Ga0466732_121638 | 3300042656 | Bacteria | 5699 |
| 99 | Ga0466733_001144 | 3300042659 | Bacteria | 4616 |
| 100 | Ga0466733_028220 | 3300042659 | Unclassified | 5165 |
| 101 | Ga0466711_096348 | 3300042615 | Bacteria | 13113 |
| 102 | Ga0466726_061376 | 3300042619 | Unclassified | 2090 |
| 103 | Ga0466728_375903 | 3300042620 | Bacteria | 11149 |
| 104 | Ga0466714_118843 | 3300042603 | Bacteria | 1182 |
| 105 | Ga0466717_182004 | 3300042604 | Bacteria | 1791 |
| 106 | Ga0466720_023132 | 3300042607 | Bacteria | 6990 |
| 107 | Ga0466720_115208 | 3300042607 | Bacteria | 9027 |
| 108 | Ga0466698_201758 | 3300042610 | Bacteria | 1059 |
| 109 | Ga0264413_126436 | 3300024493 | Bacteria | 2479 |
| 110 | Ga0466693_152830 | 3300042592 | Bacteria | 52782 |
| 111 | Ga0466694_332414 | 3300042594 | Bacteria | 2036 |
| 112 | Ga0466699_413294 | 3300042597 | Bacteria | 25958 |
| 113 | Ga0123357_10430678 | 3300009784 | Bacteria | 1166 |
| 114 | Ga0123356_10001575 | 3300010049 | Bacteria | 25090 |
| 115 | Ga0123356_10017091 | 3300010049 | Bacteria | 6904 |
| 116 | Ga0123356_10048311 | 3300010049 | Bacteria | 3960 |
| 117 | Ga0123356_10795830 | 3300010049 | Bacteria | 1116 |
| 118 | Ga0466704_051666 | 3300042643 | Bacteria | 7449 |
| 119 | Ga0466709_067608 | 3300042648 | Bacteria | 24200 |
| 120 | AustNasuHG_c1038896 | 3300000089 | Bacteria | 1190 |
| 121 | JGI24698J34947_10053618 | 3300002449 | Bacteria | 2017 |
| 122 | Ga0068305_10061278 | 3300005083 | Bacteria | 11222 |
| 123 | Ga0466732_235041 | 3300042656 | Unclassified | 1665 |
| 124 | Ga0466733_141420 | 3300042659 | Bacteria | 62681 |
| 125 | Ga0466712_172065 | 3300042614 | Unclassified | 3352 |
| 126 | Ga0466718_131236 | 3300042617 | Bacteria | 16931 |
| 127 | Ga0466726_089705 | 3300042619 | Bacteria | 1841 |
| 128 | Ga0466707_168163 | 3300042601 | Bacteria | 1379 |
| 129 | Ga0466716_102525 | 3300042605 | Bacteria | 18805 |
| 130 | Ga0466722_095351 | 3300042609 | Bacteria | 10158 |
| 131 | Ga0466722_125296 | 3300042609 | Bacteria | 8261 |
| 132 | Ga0466695_315985 | 3300042595 | Bacteria | 38906 |
| 133 | Ga0466699_013531 | 3300042597 | Bacteria | 1021 |
| 134 | Ga0466699_127032 | 3300042597 | Unclassified | 1079 |
| 135 | Ga0123356_10013061 | 3300010049 | Bacteria | 8035 |
| 136 | Ga0123356_10013697 | 3300010049 | Bacteria | 7813 |
| 137 | Ga0466730_022153 | 3300042625 | Bacteria | 1654 |
| 138 | Ga0466702_423106 | 3300042635 | Bacteria | 1768 |
| 139 | JGI24702J35022_10047458 | 3300002462 | Bacteria | 2286 |
| 140 | JGI24702J35022_10053470 | 3300002462 | Bacteria | 2154 |
| 141 | JGI24697J35500_11274393 | 3300002507 | Bacteria | 7192 |
| 142 | Ga0068302_10235442 | 3300005071 | Unclassified | 1914 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300041968 | Ga0456237_0001404 | Ga0456237_0001404_411_1154 | 247 |
| 2 | 3300042594 | Ga0466694_234808 | Ga0466694_234808_1255_1998 | 247 |
| 3 | 3300042596 | Ga0466696_113981 | Ga0466696_113981_1123_1866 | 247 |
| 4 | 3300042597 | Ga0466699_013531 | Ga0466699_013531_152_895 | 247 |
| 5 | 3300042597 | Ga0466699_127032 | Ga0466699_127032_78_821 | 247 |
| 6 | 3300042597 | Ga0466699_436518 | Ga0466699_436518_36_779 | 247 |
| 7 | 3300042607 | Ga0466720_115208 | Ga0466720_115208_7945_8688 | 247 |
| 8 | 3300042614 | Ga0466712_237071 | Ga0466712_237071_1119_1862 | 247 |
| 9 | 3300042617 | Ga0466718_057919 | Ga0466718_057919_376_1119 | 247 |
| 10 | 3300042617 | Ga0466718_090449 | Ga0466718_090449_356_1099 | 247 |
| 11 | 3300042617 | Ga0466718_111789 | Ga0466718_111789_4929_5672 | 247 |
| 12 | 3300042617 | Ga0466718_159975 | Ga0466718_159975_495_1238 | 247 |
| 13 | 3300042619 | Ga0466726_061376 | Ga0466726_061376_19_762 | 247 |
| 14 | 3300042619 | Ga0466726_089705 | Ga0466726_089705_82_825 | 247 |
| 15 | 3300042619 | Ga0466726_464550 | Ga0466726_464550_2177_2920 | 247 |
| 16 | 3300042624 | Ga0466735_019868 | Ga0466735_019868_1064_1807 | 247 |
| 17 | 3300042636 | Ga0466703_224035 | Ga0466703_224035_4836_5579 | 247 |
| 18 | 3300042652 | Ga0466708_383745 | Ga0466708_383745_30_773 | 247 |
| 19 | 3300042656 | Ga0466732_235041 | Ga0466732_235041_74_817 | 247 |
| 20 | 3300010049 | Ga0123356_10795830 | Ga0123356_107958302 | 248 |
| 21 | 3300042659 | Ga0466733_001144 | Ga0466733_001144_1858_2610 | 250 |
| 22 | 3300042656 | Ga0466732_192036 | Ga0466732_192036_2811_3653 | 257 |
| 23 | 3300010049 | Ga0123356_10017091 | Ga0123356_100170913 | 263 |
| 24 | 3300010049 | Ga0123356_10048311 | Ga0123356_100483113 | 263 |
| 25 | 3300042619 | Ga0466726_066536 | Ga0466726_066536_2314_3147 | 263 |
| 26 | 3300000089 | AustNasuHG_c1007557 | AustNasuHG_10075574 | 264 |
| 27 | 3300005071 | Ga0068302_10235442 | Ga0068302_102354421 | 265 |
| 28 | 3300042596 | Ga0466696_060405 | Ga0466696_060405_2848_3687 | 266 |
| 29 | 3300042652 | Ga0466708_139430 | Ga0466708_139430_13445_14284 | 266 |
| 30 | 3300010049 | Ga0123356_10013697 | Ga0123356_100136972 | 268 |
| 31 | 3300042607 | Ga0466720_141787 | Ga0466720_141787_1154_1990 | 268 |
| 32 | 3300042655 | Ga0466727_173603 | Ga0466727_173603_8152_8997 | 268 |
| 33 | 3300042594 | Ga0466694_332414 | Ga0466694_332414_280_1089 | 269 |
| 34 | 3300042607 | Ga0466720_144023 | Ga0466720_144023_14493_15302 | 269 |
| 35 | 3300002462 | JGI24702J35022_10092500 | JGI24702J35022_100925002 | 270 |
| 36 | 3300010049 | Ga0123356_10621125 | Ga0123356_106211252 | 270 |
| 37 | 3300041968 | Ga0456237_0002720 | Ga0456237_0002720_1132_1974 | 270 |
| 38 | 3300042615 | Ga0466711_021704 | Ga0466711_021704_679_1518 | 272 |
| 39 | 3300010049 | Ga0123356_10001575 | Ga0123356_100015757 | 276 |
| 40 | 3300024493 | Ga0264413_126436 | Ga0264413_1264363 | 277 |
| 41 | 3300042591 | Ga0466692_045618 | Ga0466692_045618_2039_2872 | 277 |
| 42 | 3300042594 | Ga0466694_112875 | Ga0466694_112875_2486_3319 | 277 |
| 43 | 3300042594 | Ga0466694_285595 | Ga0466694_285595_255_1088 | 277 |
| 44 | 3300042594 | Ga0466694_385720 | Ga0466694_385720_815_1648 | 277 |
| 45 | 3300042597 | Ga0466699_021017 | Ga0466699_021017_346_1179 | 277 |
| 46 | 3300042597 | Ga0466699_072196 | Ga0466699_072196_38912_39745 | 277 |
| 47 | 3300042597 | Ga0466699_299905 | Ga0466699_299905_27_860 | 277 |
| 48 | 3300042597 | Ga0466699_413294 | Ga0466699_413294_24067_24900 | 277 |
| 49 | 3300042603 | Ga0466714_118843 | Ga0466714_118843_237_1070 | 277 |
| 50 | 3300042604 | Ga0466717_182004 | Ga0466717_182004_231_1064 | 277 |
| 51 | 3300042607 | Ga0466720_023132 | Ga0466720_023132_4116_4949 | 277 |
| 52 | 3300042609 | Ga0466722_008188 | Ga0466722_008188_2609_3442 | 277 |
| 53 | 3300042609 | Ga0466722_019228 | Ga0466722_019228_1157_1990 | 277 |
| 54 | 3300042609 | Ga0466722_066215 | Ga0466722_066215_1007_1840 | 277 |
| 55 | 3300042609 | Ga0466722_125296 | Ga0466722_125296_1523_2356 | 277 |
| 56 | 3300042609 | Ga0466722_142246 | Ga0466722_142246_614_1447 | 277 |
| 57 | 3300042609 | Ga0466722_220246 | Ga0466722_220246_727_1560 | 277 |
| 58 | 3300042610 | Ga0466698_168285 | Ga0466698_168285_2865_3698 | 277 |
| 59 | 3300042610 | Ga0466698_201758 | Ga0466698_201758_156_989 | 277 |
| 60 | 3300042614 | Ga0466712_077031 | Ga0466712_077031_3026_3859 | 277 |
| 61 | 3300042614 | Ga0466712_095563 | Ga0466712_095563_551_1384 | 277 |
| 62 | 3300042614 | Ga0466712_172065 | Ga0466712_172065_1953_2786 | 277 |
| 63 | 3300042614 | Ga0466712_193587 | Ga0466712_193587_1185_2018 | 277 |
| 64 | 3300042614 | Ga0466712_210197 | Ga0466712_210197_295_1128 | 277 |
| 65 | 3300042617 | Ga0466718_131236 | Ga0466718_131236_5482_6315 | 277 |
| 66 | 3300042617 | Ga0466718_163443 | Ga0466718_163443_47_880 | 277 |
| 67 | 3300042625 | Ga0466730_022153 | Ga0466730_022153_750_1583 | 277 |
| 68 | 3300042635 | Ga0466702_423106 | Ga0466702_423106_316_1149 | 277 |
| 69 | 3300042656 | Ga0466732_029119 | Ga0466732_029119_254_1087 | 277 |
| 70 | 3300042656 | Ga0466732_121638 | Ga0466732_121638_1423_2256 | 277 |
| 71 | 3300042656 | Ga0466732_310078 | Ga0466732_310078_1130_1963 | 277 |
| 72 | iso_pr_bacteria | 2781125651 | 2781310100 | 277 |
| 73 | iso_pr_bacteria | 2781125691 | 2781428934 | 277 |
| 74 | iso_pr_bacteria | 2781125692 | 2781430751 | 277 |
| 75 | 3300000089 | AustNasuHG_c1038896 | AustNasuHG_10388962 | 278 |
| 76 | 3300002449 | JGI24698J34947_10053618 | JGI24698J34947_100536183 | 278 |
| 77 | 3300002449 | JGI24698J34947_10078012 | JGI24698J34947_100780122 | 278 |
| 78 | 3300002450 | JGI24695J34938_10007362 | JGI24695J34938_100073622 | 278 |
| 79 | 3300002462 | JGI24702J35022_10004788 | JGI24702J35022_100047883 | 278 |
| 80 | 3300002462 | JGI24702J35022_10019359 | JGI24702J35022_100193596 | 278 |
| 81 | 3300002462 | JGI24702J35022_10053470 | JGI24702J35022_100534702 | 278 |
| 82 | 3300002504 | JGI24705J35276_12133589 | JGI24705J35276_121335892 | 278 |
| 83 | 3300002504 | JGI24705J35276_12173932 | JGI24705J35276_121739321 | 278 |
| 84 | 3300002504 | JGI24705J35276_12184735 | JGI24705J35276_121847352 | 278 |
| 85 | 3300002504 | JGI24705J35276_12219803 | JGI24705J35276_122198032 | 278 |
| 86 | 3300002507 | JGI24697J35500_11274393 | JGI24697J35500_112743932 | 278 |
| 87 | 3300009784 | Ga0123357_10096980 | Ga0123357_100969802 | 278 |
| 88 | 3300009784 | Ga0123357_10430678 | Ga0123357_104306781 | 278 |
| 89 | 3300010167 | Ga0123353_10021687 | Ga0123353_100216874 | 278 |
| 90 | 3300010167 | Ga0123353_10387401 | Ga0123353_103874012 | 278 |
| 91 | 3300010882 | Ga0123354_10287637 | Ga0123354_102876372 | 278 |
| 92 | 3300042615 | Ga0466711_517498 | Ga0466711_517498_9152_9988 | 278 |
| 93 | 3300042624 | Ga0466735_152216 | Ga0466735_152216_105_941 | 278 |
| 94 | 3300000089 | AustNasuHG_c1004370 | AustNasuHG_10043704 | 279 |
| 95 | 3300002449 | JGI24698J34947_10002394 | JGI24698J34947_100023943 | 279 |
| 96 | 3300002462 | JGI24702J35022_10047458 | JGI24702J35022_100474582 | 279 |
| 97 | 3300009826 | Ga0123355_10559350 | Ga0123355_105593501 | 279 |
| 98 | 3300010882 | Ga0123354_10407091 | Ga0123354_104070911 | 279 |
| 99 | 3300042590 | Ga0466690_236481 | Ga0466690_236481_10006_10845 | 279 |
| 100 | 3300042591 | Ga0466692_047928 | Ga0466692_047928_23232_24071 | 279 |
| 101 | 3300042593 | Ga0466691_060681 | Ga0466691_060681_7450_8289 | 279 |
| 102 | 3300042596 | Ga0466696_355841 | Ga0466696_355841_4413_5252 | 279 |
| 103 | 3300042601 | Ga0466707_124937 | Ga0466707_124937_556_1395 | 279 |
| 104 | 3300042605 | Ga0466716_102525 | Ga0466716_102525_6011_6850 | 279 |
| 105 | 3300042606 | Ga0466719_023416 | Ga0466719_023416_6761_7600 | 279 |
| 106 | 3300042606 | Ga0466719_359508 | Ga0466719_359508_1280_2119 | 279 |
| 107 | 3300042606 | Ga0466719_516068 | Ga0466719_516068_301_1140 | 279 |
| 108 | 3300042609 | Ga0466722_095351 | Ga0466722_095351_5569_6408 | 279 |
| 109 | 3300042610 | Ga0466698_257566 | Ga0466698_257566_1044_1883 | 279 |
| 110 | 3300042612 | Ga0466705_060804 | Ga0466705_060804_513_1352 | 279 |
| 111 | 3300042615 | Ga0466711_096348 | Ga0466711_096348_2475_3314 | 279 |
| 112 | 3300042619 | Ga0466726_050722 | Ga0466726_050722_25745_26584 | 279 |
| 113 | 3300042619 | Ga0466726_407357 | Ga0466726_407357_1498_2337 | 279 |
| 114 | 3300042620 | Ga0466728_138342 | Ga0466728_138342_332_1171 | 279 |
| 115 | 3300042620 | Ga0466728_375903 | Ga0466728_375903_5843_6682 | 279 |
| 116 | 3300042636 | Ga0466703_061593 | Ga0466703_061593_12550_13389 | 279 |
| 117 | 3300042643 | Ga0466704_036073 | Ga0466704_036073_100_939 | 279 |
| 118 | 3300042643 | Ga0466704_051666 | Ga0466704_051666_1288_2127 | 279 |
| 119 | 3300042643 | Ga0466704_110697 | Ga0466704_110697_100_939 | 279 |
| 120 | 3300042648 | Ga0466709_067608 | Ga0466709_067608_3148_3987 | 279 |
| 121 | 3300042648 | Ga0466709_259288 | Ga0466709_259288_2437_3276 | 279 |
| 122 | 3300042652 | Ga0466708_394409 | Ga0466708_394409_6498_7337 | 279 |
| 123 | 3300042652 | Ga0466708_415237 | Ga0466708_415237_4203_5042 | 279 |
| 124 | 3300042656 | Ga0466732_036891 | Ga0466732_036891_3505_4344 | 279 |
| 125 | 3300042656 | Ga0466732_186343 | Ga0466732_186343_149_988 | 279 |
| 126 | iso_pr_bacteria | 650716099 | 650879286 | 279 |
| 127 | 3300005083 | Ga0068305_10061278 | Ga0068305_100612784 | 280 |
| 128 | 3300010167 | Ga0123353_10222334 | Ga0123353_102223342 | 280 |
| 129 | 3300010167 | Ga0123353_10455610 | Ga0123353_104556102 | 280 |
| 130 | 3300042595 | Ga0466695_340113 | Ga0466695_340113_1633_2475 | 280 |
| 131 | 3300042619 | Ga0466726_317950 | Ga0466726_317950_64_906 | 280 |
| 132 | 3300042648 | Ga0466709_368115 | Ga0466709_368115_451_1293 | 280 |
| 133 | iso_pr_bacteria | 2772190975 | 2773723965 | 280 |
| 134 | 3300042659 | Ga0466733_004126 | Ga0466733_004126_1004_1849 | 281 |
| 135 | 3300042659 | Ga0466733_028220 | Ga0466733_028220_2269_3114 | 281 |
| 136 | 3300042659 | Ga0466733_141420 | Ga0466733_141420_56510_57355 | 281 |
| 137 | 3300042659 | Ga0466733_150287 | Ga0466733_150287_4588_5433 | 281 |
| 138 | 3300010049 | Ga0123356_10013061 | Ga0123356_100130617 | 282 |
| 139 | 3300042595 | Ga0466695_315985 | Ga0466695_315985_35086_35934 | 282 |
| 140 | 3300000089 | AustNasuHG_c1003161 | AustNasuHG_10031612 | 283 |
| 141 | 3300042592 | Ga0466693_152830 | Ga0466693_152830_29788_30639 | 283 |
| 142 | 3300002449 | JGI24698J34947_10017122 | JGI24698J34947_100171223 | 284 |
| 143 | 3300002450 | JGI24695J34938_10004451 | JGI24695J34938_100044514 | 284 |
| 144 | 3300042601 | Ga0466707_168163 | Ga0466707_168163_60_917 | 285 |
| 145 | 3300042656 | Ga0466732_172430 | Ga0466732_172430_449_1309 | 286 |
| 146 | 3300042656 | Ga0466732_195229 | Ga0466732_195229_782_1642 | 286 |
| 147 | iso_pr_bacteria | 2781125661 | 2781333614 | 288 |
| 148 | 3300042607 | Ga0466720_224918 | Ga0466720_224918_1461_2357 | 298 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 108 | 283 | 0.79 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.62 | 0.72 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.