Protein Family IF06681
Metagenome
Isolate
145
Members
48
Samples
136
Scaffolds
134.62
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_183807|Ga0466720_183807_18_506
- Length
- 162 aa
- Sequence
- MAKGGIVGGACPAAENRGVLVPVEEGCRMKLKRAKDKNFTIPLNSMSDVAFLLLIFIMVIALINFRKEIHIEYATAETVLNTGAEQNLEVWVDIEGNIYIAGDPADIPILEQTVADLYTGAPDTRIHILADRNTPYEKISAVLEVLQILQYRTVSFVVKNAE
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.3%
Kalotermitidae
24.4%
Unclassified
20.0%
Hodotermitidae
2.2%
Taxonomy
Archaea
1
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 32 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 33 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 34 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 35 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 36 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 40 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 41 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 42 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 43 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10148130 | 3300002449 | Bacteria | 979 |
| 2 | JGI24698J34947_10219456 | 3300002449 | Bacteria | 730 |
| 3 | JGI24695J34938_10031154 | 3300002450 | Bacteria | 2478 |
| 4 | JGI24695J34938_10192622 | 3300002450 | Bacteria | 847 |
| 5 | JGI24695J34938_10392447 | 3300002450 | Bacteria | 617 |
| 6 | JGI24699J35502_11008127 | 3300002509 | Bacteria | 1386 |
| 7 | Ga0072941_1027778 | 3300005201 | Bacteria | 16466 |
| 8 | Ga0123353_10634586 | 3300010167 | Bacteria | 1517 |
| 9 | Ga0466714_097326 | 3300042603 | Bacteria | 1137 |
| 10 | Ga0466709_074782 | 3300042648 | Bacteria | 1691 |
| 11 | Ga0264413_108716 | 3300024493 | Bacteria | 10282 |
| 12 | Ga0466693_170052 | 3300042592 | Bacteria | 1047 |
| 13 | JGI24698J34947_10029128 | 3300002449 | Bacteria | 2919 |
| 14 | JGI24695J34938_10002269 | 3300002450 | Bacteria | 14854 |
| 15 | JGI24695J34938_10071140 | 3300002450 | Bacteria | 1454 |
| 16 | JGI24695J34938_10394337 | 3300002450 | Bacteria | 616 |
| 17 | JGI24705J35276_11837334 | 3300002504 | Bacteria | 706 |
| 18 | Ga0072940_1094808 | 3300005200 | Unclassified | 4089 |
| 19 | Ga0072941_1007286 | 3300005201 | Bacteria | 4846 |
| 20 | Ga0072941_1049837 | 3300005201 | Bacteria | 6248 |
| 21 | Ga0123353_10194079 | 3300010167 | Bacteria | 3202 |
| 22 | Ga0123353_12022574 | 3300010167 | Bacteria | 705 |
| 23 | Ga0466718_099143 | 3300042617 | Bacteria | 25542 |
| 24 | Ga0466720_055314 | 3300042607 | Bacteria | 3848 |
| 25 | Ga0466721_213888 | 3300042608 | Bacteria | 1747 |
| 26 | Ga0466698_486454 | 3300042610 | Bacteria | 2403 |
| 27 | Ga0466702_443143 | 3300042635 | Bacteria | 8375 |
| 28 | Ga0264413_106982 | 3300024493 | Unclassified | 5099 |
| 29 | Ga0415639_252528 | 3300038395 | Bacteria | 1609 |
| 30 | Ga0466691_147397 | 3300042593 | Bacteria | 2686 |
| 31 | Ga0466699_256075 | 3300042597 | Bacteria | 1277 |
| 32 | Ga0466732_028809 | 3300042656 | Bacteria | 3378 |
| 33 | AustNasuHG_c1003835 | 3300000089 | Bacteria | 5415 |
| 34 | AustNasuHG_c1007111 | 3300000089 | Bacteria | 3987 |
| 35 | FAAS_10348495 | 3300001880 | Bacteria | 523 |
| 36 | JGI24698J34947_10068388 | 3300002449 | Bacteria | 1718 |
| 37 | JGI24695J34938_10195520 | 3300002450 | Bacteria | 841 |
| 38 | Ga0072941_1047229 | 3300005201 | Bacteria | 2696 |
| 39 | Ga0123356_10000079 | 3300010049 | Bacteria | 103173 |
| 40 | Ga0466718_088424 | 3300042617 | Bacteria | 3632 |
| 41 | Ga0466723_253111 | 3300042618 | Bacteria | 23254 |
| 42 | Ga0466719_295254 | 3300042606 | Bacteria | 26745 |
| 43 | Ga0466719_327683 | 3300042606 | Bacteria | 1419 |
| 44 | Ga0466720_033754 | 3300042607 | Bacteria | 3056 |
| 45 | Ga0466720_034318 | 3300042607 | Bacteria | 32841 |
| 46 | Ga0466720_044105 | 3300042607 | Bacteria | 31294 |
| 47 | Ga0466720_083290 | 3300042607 | Bacteria | 4978 |
| 48 | Ga0466720_197285 | 3300042607 | Bacteria | 4058 |
| 49 | Ga0466702_036383 | 3300042635 | Bacteria | 3043 |
| 50 | Ga0466702_159637 | 3300042635 | Bacteria | 1721 |
| 51 | Ga0466703_108701 | 3300042636 | Bacteria | 1124 |
| 52 | Ga0264413_135757 | 3300024493 | Unclassified | 3954 |
| 53 | Ga0466693_157528 | 3300042592 | Bacteria | 2087 |
| 54 | Ga0466699_238454 | 3300042597 | Bacteria | 9377 |
| 55 | JGI24698J34947_10095604 | 3300002449 | Archaea | 1350 |
| 56 | JGI24698J34947_10308123 | 3300002449 | Unclassified | 568 |
| 57 | Ga0072940_1018190 | 3300005200 | Bacteria | 3110 |
| 58 | Ga0072940_1027405 | 3300005200 | Bacteria | 3822 |
| 59 | Ga0466700_386410 | 3300042600 | Bacteria | 1507 |
| 60 | Ga0466698_264175 | 3300042610 | Bacteria | 5267 |
| 61 | Ga0466709_149610 | 3300042648 | Bacteria | 9158 |
| 62 | Ga0264413_116179 | 3300024493 | Bacteria | 12169 |
| 63 | JGI24698J34947_10002144 | 3300002449 | Bacteria | 10569 |
| 64 | JGI24698J34947_10069151 | 3300002449 | Unclassified | 1705 |
| 65 | JGI24695J34938_10024506 | 3300002450 | Bacteria | 2897 |
| 66 | JGI24702J35022_10012244 | 3300002462 | Bacteria | 4772 |
| 67 | JGI24699J35502_11115663 | 3300002509 | Bacteria | 2928 |
| 68 | Ga0123356_12682674 | 3300010049 | Bacteria | 624 |
| 69 | Ga0466712_133856 | 3300042614 | Unclassified | 8851 |
| 70 | Ga0466718_010368 | 3300042617 | Bacteria | 37109 |
| 71 | Ga0466718_040277 | 3300042617 | Bacteria | 2661 |
| 72 | Ga0466728_257344 | 3300042620 | Bacteria | 7222 |
| 73 | Ga0466700_402131 | 3300042600 | Bacteria | 1375 |
| 74 | Ga0466720_058238 | 3300042607 | Bacteria | 4515 |
| 75 | Ga0466720_063386 | 3300042607 | Bacteria | 7122 |
| 76 | Ga0466720_135826 | 3300042607 | Unclassified | 6278 |
| 77 | Ga0466720_183807 | 3300042607 | Bacteria | 3357 |
| 78 | Ga0466698_378027 | 3300042610 | Bacteria | 1272 |
| 79 | Ga0466704_035569 | 3300042643 | Bacteria | 21995 |
| 80 | Ga0415639_010118 | 3300038395 | Bacteria | 24127 |
| 81 | Ga0466699_128530 | 3300042597 | Bacteria | 2252 |
| 82 | Ga0466699_229850 | 3300042597 | Bacteria | 35684 |
| 83 | Ga0466732_218063 | 3300042656 | Bacteria | 55897 |
| 84 | JGI24698J34947_10002768 | 3300002449 | Bacteria | 9487 |
| 85 | JGI24698J34947_10010286 | 3300002449 | Bacteria | 5129 |
| 86 | JGI24698J34947_10118340 | 3300002449 | Bacteria | 1155 |
| 87 | JGI24695J34938_10092183 | 3300002450 | Bacteria | 1242 |
| 88 | Ga0466711_209387 | 3300042615 | Bacteria | 1154 |
| 89 | Ga0466715_217687 | 3300042616 | Bacteria | 2033 |
| 90 | Ga0466700_050259 | 3300042600 | Bacteria | 3156 |
| 91 | Ga0466720_096500 | 3300042607 | Bacteria | 25465 |
| 92 | Ga0466720_099821 | 3300042607 | Bacteria | 83537 |
| 93 | Ga0466720_198414 | 3300042607 | Bacteria | 1609 |
| 94 | Ga0466702_127482 | 3300042635 | Bacteria | 6556 |
| 95 | Ga0466702_376079 | 3300042635 | Bacteria | 1377 |
| 96 | Ga0264413_110814 | 3300024493 | Unclassified | 4551 |
| 97 | Ga0466693_205088 | 3300042592 | Bacteria | 3252 |
| 98 | Ga0466694_230555 | 3300042594 | Bacteria | 4479 |
| 99 | Ga0466699_249509 | 3300042597 | Bacteria | 1044 |
| 100 | AustNasuHG_c1011840 | 3300000089 | Bacteria | 3020 |
| 101 | JGI24698J34947_10037190 | 3300002449 | Bacteria | 2531 |
| 102 | JGI24699J35502_10604722 | 3300002509 | Bacteria | 685 |
| 103 | Ga0072940_1044270 | 3300005200 | Bacteria | 5337 |
| 104 | Ga0123356_11311721 | 3300010049 | Bacteria | 887 |
| 105 | Ga0466712_016990 | 3300042614 | Bacteria | 12523 |
| 106 | Ga0466718_054807 | 3300042617 | Bacteria | 1482 |
| 107 | Ga0466718_117288 | 3300042617 | Bacteria | 4320 |
| 108 | Ga0466706_288536 | 3300042599 | Bacteria | 1698 |
| 109 | Ga0466707_258232 | 3300042601 | Bacteria | 5420 |
| 110 | Ga0466720_116674 | 3300042607 | Bacteria | 1861 |
| 111 | Ga0466720_167154 | 3300042607 | Bacteria | 2977 |
| 112 | Ga0466731_104275 | 3300042622 | Bacteria | 1188 |
| 113 | Ga0466708_450977 | 3300042652 | Bacteria | 1372 |
| 114 | Ga0466694_151362 | 3300042594 | Bacteria | 2595 |
| 115 | Ga0466699_187237 | 3300042597 | Bacteria | 8249 |
| 116 | Ga0466705_118918 | 3300042612 | Bacteria | 1233 |
| 117 | Ga0466705_200097 | 3300042612 | Bacteria | 1009 |
| 118 | Ga0466732_027818 | 3300042656 | Bacteria | 1378 |
| 119 | Ga0466732_263916 | 3300042656 | Bacteria | 9864 |
| 120 | JGI24698J34947_10088862 | 3300002449 | Bacteria | 1424 |
| 121 | JGI24695J34938_10000315 | 3300002450 | Bacteria | 47627 |
| 122 | JGI24695J34938_10018389 | 3300002450 | Bacteria | 3496 |
| 123 | Ga0072940_1161568 | 3300005200 | Bacteria | 1427 |
| 124 | Ga0123356_10001627 | 3300010049 | Bacteria | 24649 |
| 125 | Ga0123353_10709180 | 3300010167 | Bacteria | 1410 |
| 126 | Ga0466711_090953 | 3300042615 | Bacteria | 1538 |
| 127 | Ga0466728_185472 | 3300042620 | Bacteria | 2037 |
| 128 | Ga0466720_123392 | 3300042607 | Unclassified | 1044 |
| 129 | Ga0466730_077402 | 3300042625 | Bacteria | 1133 |
| 130 | Ga0264413_116180 | 3300024493 | Bacteria | 6515 |
| 131 | Ga0466691_052551 | 3300042593 | Bacteria | 7492 |
| 132 | Ga0466694_039008 | 3300042594 | Bacteria | 1176 |
| 133 | Ga0466694_375794 | 3300042594 | Bacteria | 1936 |
| 134 | Ga0466699_166495 | 3300042597 | Bacteria | 1203 |
| 135 | Ga0466699_179223 | 3300042597 | Bacteria | 1261 |
| 136 | Ga0466699_240564 | 3300042597 | Bacteria | 1513 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042620 | Ga0466728_257344 | Ga0466728_257344_5082_5474 | 130 |
| 2 | 3300042597 | Ga0466699_256075 | Ga0466699_256075_477_875 | 132 |
| 3 | 3300042606 | Ga0466719_295254 | Ga0466719_295254_11626_12024 | 132 |
| 4 | 3300042612 | Ga0466705_200097 | Ga0466705_200097_294_692 | 132 |
| 5 | 3300042656 | Ga0466732_027818 | Ga0466732_027818_596_994 | 132 |
| 6 | iso_pr_bacteria | 650716099 | 650879044 | 132 |
| 7 | 3300010167 | Ga0123353_10634586 | Ga0123353_106345862 | 133 |
| 8 | 3300010167 | Ga0123353_10709180 | Ga0123353_107091802 | 133 |
| 9 | 3300010167 | Ga0123353_12022574 | Ga0123353_120225742 | 133 |
| 10 | 3300038395 | Ga0415639_010118 | Ga0415639_010118_4869_5270 | 133 |
| 11 | 3300038395 | Ga0415639_252528 | Ga0415639_252528_816_1217 | 133 |
| 12 | 3300042593 | Ga0466691_052551 | Ga0466691_052551_852_1253 | 133 |
| 13 | 3300042593 | Ga0466691_147397 | Ga0466691_147397_1894_2295 | 133 |
| 14 | 3300042599 | Ga0466706_288536 | Ga0466706_288536_949_1350 | 133 |
| 15 | 3300042606 | Ga0466719_327683 | Ga0466719_327683_311_712 | 133 |
| 16 | 3300042608 | Ga0466721_213888 | Ga0466721_213888_373_774 | 133 |
| 17 | 3300042615 | Ga0466711_209387 | Ga0466711_209387_287_688 | 133 |
| 18 | 3300042616 | Ga0466715_217687 | Ga0466715_217687_1029_1430 | 133 |
| 19 | 3300042617 | Ga0466718_117288 | Ga0466718_117288_3068_3469 | 133 |
| 20 | 3300042618 | Ga0466723_253111 | Ga0466723_253111_17489_17890 | 133 |
| 21 | 3300042622 | Ga0466731_104275 | Ga0466731_104275_187_588 | 133 |
| 22 | 3300042636 | Ga0466703_108701 | Ga0466703_108701_700_1101 | 133 |
| 23 | 3300042648 | Ga0466709_074782 | Ga0466709_074782_124_525 | 133 |
| 24 | 3300042652 | Ga0466708_450977 | Ga0466708_450977_165_566 | 133 |
| 25 | iso_pr_bacteria | 2781125635 | 2781277962 | 133 |
| 26 | iso_pr_bacteria | 2781125645 | 2781299406 | 133 |
| 27 | iso_pr_bacteria | 2781125645 | 2781299786 | 133 |
| 28 | iso_pr_bacteria | 2781125657 | 2781322828 | 133 |
| 29 | 3300002449 | JGI24698J34947_10118340 | JGI24698J34947_101183402 | 134 |
| 30 | 3300002450 | JGI24695J34938_10000315 | JGI24695J34938_1000031514 | 134 |
| 31 | 3300002450 | JGI24695J34938_10002269 | JGI24695J34938_100022696 | 134 |
| 32 | 3300002450 | JGI24695J34938_10018389 | JGI24695J34938_100183894 | 134 |
| 33 | 3300002450 | JGI24695J34938_10024506 | JGI24695J34938_100245064 | 134 |
| 34 | 3300002450 | JGI24695J34938_10071140 | JGI24695J34938_100711402 | 134 |
| 35 | 3300002450 | JGI24695J34938_10092183 | JGI24695J34938_100921831 | 134 |
| 36 | 3300002450 | JGI24695J34938_10192622 | JGI24695J34938_101926222 | 134 |
| 37 | 3300002450 | JGI24695J34938_10392447 | JGI24695J34938_103924471 | 134 |
| 38 | 3300002450 | JGI24695J34938_10394337 | JGI24695J34938_103943372 | 134 |
| 39 | 3300002509 | JGI24699J35502_11115663 | JGI24699J35502_111156633 | 134 |
| 40 | 3300010049 | Ga0123356_10000079 | Ga0123356_1000007933 | 134 |
| 41 | 3300010049 | Ga0123356_11311721 | Ga0123356_113117212 | 134 |
| 42 | 3300010049 | Ga0123356_12682674 | Ga0123356_126826741 | 134 |
| 43 | 3300024493 | Ga0264413_106982 | Ga0264413_1069823 | 134 |
| 44 | 3300024493 | Ga0264413_108716 | Ga0264413_1087167 | 134 |
| 45 | 3300024493 | Ga0264413_110814 | Ga0264413_1108142 | 134 |
| 46 | 3300024493 | Ga0264413_116179 | Ga0264413_11617910 | 134 |
| 47 | 3300024493 | Ga0264413_116180 | Ga0264413_1161805 | 134 |
| 48 | 3300024493 | Ga0264413_135757 | Ga0264413_1357573 | 134 |
| 49 | 3300042594 | Ga0466694_039008 | Ga0466694_039008_384_788 | 134 |
| 50 | 3300042594 | Ga0466694_151362 | Ga0466694_151362_1983_2387 | 134 |
| 51 | 3300042594 | Ga0466694_230555 | Ga0466694_230555_2338_2742 | 134 |
| 52 | 3300042594 | Ga0466694_375794 | Ga0466694_375794_1289_1693 | 134 |
| 53 | 3300042597 | Ga0466699_128530 | Ga0466699_128530_1124_1528 | 134 |
| 54 | 3300042597 | Ga0466699_179223 | Ga0466699_179223_101_505 | 134 |
| 55 | 3300042597 | Ga0466699_187237 | Ga0466699_187237_4133_4537 | 134 |
| 56 | 3300042597 | Ga0466699_229850 | Ga0466699_229850_9537_9941 | 134 |
| 57 | 3300042597 | Ga0466699_238454 | Ga0466699_238454_598_1002 | 134 |
| 58 | 3300042597 | Ga0466699_240564 | Ga0466699_240564_378_782 | 134 |
| 59 | 3300042597 | Ga0466699_249509 | Ga0466699_249509_574_978 | 134 |
| 60 | 3300042600 | Ga0466700_050259 | Ga0466700_050259_467_871 | 134 |
| 61 | 3300042600 | Ga0466700_386410 | Ga0466700_386410_637_1041 | 134 |
| 62 | 3300042600 | Ga0466700_402131 | Ga0466700_402131_715_1119 | 134 |
| 63 | 3300042601 | Ga0466707_258232 | Ga0466707_258232_1430_1834 | 134 |
| 64 | 3300042603 | Ga0466714_097326 | Ga0466714_097326_655_1059 | 134 |
| 65 | 3300042607 | Ga0466720_034318 | Ga0466720_034318_17169_17573 | 134 |
| 66 | 3300042607 | Ga0466720_044105 | Ga0466720_044105_9638_10042 | 134 |
| 67 | 3300042607 | Ga0466720_055314 | Ga0466720_055314_3106_3510 | 134 |
| 68 | 3300042607 | Ga0466720_058238 | Ga0466720_058238_3084_3488 | 134 |
| 69 | 3300042607 | Ga0466720_099821 | Ga0466720_099821_57100_57504 | 134 |
| 70 | 3300042607 | Ga0466720_116674 | Ga0466720_116674_358_762 | 134 |
| 71 | 3300042607 | Ga0466720_123392 | Ga0466720_123392_561_965 | 134 |
| 72 | 3300042607 | Ga0466720_135826 | Ga0466720_135826_318_722 | 134 |
| 73 | 3300042607 | Ga0466720_167154 | Ga0466720_167154_497_901 | 134 |
| 74 | 3300042607 | Ga0466720_197285 | Ga0466720_197285_3589_3993 | 134 |
| 75 | 3300042607 | Ga0466720_198414 | Ga0466720_198414_292_696 | 134 |
| 76 | 3300042610 | Ga0466698_264175 | Ga0466698_264175_1242_1646 | 134 |
| 77 | 3300042610 | Ga0466698_378027 | Ga0466698_378027_414_818 | 134 |
| 78 | 3300042610 | Ga0466698_486454 | Ga0466698_486454_1790_2194 | 134 |
| 79 | 3300042612 | Ga0466705_118918 | Ga0466705_118918_689_1093 | 134 |
| 80 | 3300042614 | Ga0466712_016990 | Ga0466712_016990_11666_12070 | 134 |
| 81 | 3300042614 | Ga0466712_133856 | Ga0466712_133856_1868_2272 | 134 |
| 82 | 3300042615 | Ga0466711_090953 | Ga0466711_090953_551_955 | 134 |
| 83 | 3300042617 | Ga0466718_010368 | Ga0466718_010368_7971_8375 | 134 |
| 84 | 3300042617 | Ga0466718_040277 | Ga0466718_040277_590_994 | 134 |
| 85 | 3300042617 | Ga0466718_054807 | Ga0466718_054807_216_620 | 134 |
| 86 | 3300042617 | Ga0466718_088424 | Ga0466718_088424_2439_2843 | 134 |
| 87 | 3300042617 | Ga0466718_099143 | Ga0466718_099143_21859_22263 | 134 |
| 88 | 3300042620 | Ga0466728_185472 | Ga0466728_185472_919_1323 | 134 |
| 89 | 3300042625 | Ga0466730_077402 | Ga0466730_077402_42_446 | 134 |
| 90 | 3300042635 | Ga0466702_127482 | Ga0466702_127482_373_777 | 134 |
| 91 | 3300042635 | Ga0466702_159637 | Ga0466702_159637_916_1320 | 134 |
| 92 | 3300042635 | Ga0466702_376079 | Ga0466702_376079_723_1127 | 134 |
| 93 | 3300042635 | Ga0466702_443143 | Ga0466702_443143_2075_2479 | 134 |
| 94 | 3300042643 | Ga0466704_035569 | Ga0466704_035569_15010_15414 | 134 |
| 95 | 3300042648 | Ga0466709_149610 | Ga0466709_149610_3789_4193 | 134 |
| 96 | 3300042656 | Ga0466732_028809 | Ga0466732_028809_2012_2416 | 134 |
| 97 | 3300042656 | Ga0466732_218063 | Ga0466732_218063_51739_52143 | 134 |
| 98 | 3300042656 | Ga0466732_263916 | Ga0466732_263916_5617_6021 | 134 |
| 99 | iso_pr_bacteria | 2781125631 | 2781268737 | 134 |
| 100 | iso_pr_bacteria | 2781125658 | 2781325311 | 134 |
| 101 | iso_pr_bacteria | 2781125692 | 2781430950 | 134 |
| 102 | iso_pr_bacteria | 2781125695 | 2781438909 | 134 |
| 103 | 3300000089 | AustNasuHG_c1003835 | AustNasuHG_10038352 | 135 |
| 104 | 3300000089 | AustNasuHG_c1007111 | AustNasuHG_10071116 | 135 |
| 105 | 3300000089 | AustNasuHG_c1011840 | AustNasuHG_10118402 | 135 |
| 106 | 3300001880 | FAAS_10348495 | FAAS_103484951 | 135 |
| 107 | 3300002449 | JGI24698J34947_10002144 | JGI24698J34947_100021442 | 135 |
| 108 | 3300002449 | JGI24698J34947_10002768 | JGI24698J34947_100027683 | 135 |
| 109 | 3300002449 | JGI24698J34947_10010286 | JGI24698J34947_100102865 | 135 |
| 110 | 3300002449 | JGI24698J34947_10029128 | JGI24698J34947_100291284 | 135 |
| 111 | 3300002449 | JGI24698J34947_10037190 | JGI24698J34947_100371903 | 135 |
| 112 | 3300002449 | JGI24698J34947_10068388 | JGI24698J34947_100683882 | 135 |
| 113 | 3300002449 | JGI24698J34947_10069151 | JGI24698J34947_100691513 | 135 |
| 114 | 3300002449 | JGI24698J34947_10088862 | JGI24698J34947_100888622 | 135 |
| 115 | 3300002449 | JGI24698J34947_10095604 | JGI24698J34947_100956042 | 135 |
| 116 | 3300002449 | JGI24698J34947_10148130 | JGI24698J34947_101481303 | 135 |
| 117 | 3300002449 | JGI24698J34947_10219456 | JGI24698J34947_102194562 | 135 |
| 118 | 3300002449 | JGI24698J34947_10308123 | JGI24698J34947_103081231 | 135 |
| 119 | 3300002450 | JGI24695J34938_10195520 | JGI24695J34938_101955202 | 135 |
| 120 | 3300002462 | JGI24702J35022_10012244 | JGI24702J35022_100122442 | 135 |
| 121 | 3300002504 | JGI24705J35276_11837334 | JGI24705J35276_118373342 | 135 |
| 122 | 3300002509 | JGI24699J35502_10604722 | JGI24699J35502_106047221 | 135 |
| 123 | 3300002509 | JGI24699J35502_11008127 | JGI24699J35502_110081272 | 135 |
| 124 | 3300005200 | Ga0072940_1018190 | Ga0072940_10181904 | 135 |
| 125 | 3300005200 | Ga0072940_1027405 | Ga0072940_10274053 | 135 |
| 126 | 3300005200 | Ga0072940_1044270 | Ga0072940_10442705 | 135 |
| 127 | 3300005200 | Ga0072940_1094808 | Ga0072940_10948085 | 135 |
| 128 | 3300005200 | Ga0072940_1161568 | Ga0072940_11615682 | 135 |
| 129 | 3300005201 | Ga0072941_1007286 | Ga0072941_10072864 | 135 |
| 130 | 3300005201 | Ga0072941_1027778 | Ga0072941_10277783 | 135 |
| 131 | 3300005201 | Ga0072941_1047229 | Ga0072941_10472293 | 135 |
| 132 | 3300010049 | Ga0123356_10001627 | Ga0123356_1000162711 | 135 |
| 133 | 3300010167 | Ga0123353_10194079 | Ga0123353_101940793 | 135 |
| 134 | 3300042592 | Ga0466693_157528 | Ga0466693_157528_1054_1461 | 135 |
| 135 | 3300042592 | Ga0466693_170052 | Ga0466693_170052_85_492 | 135 |
| 136 | 3300042592 | Ga0466693_205088 | Ga0466693_205088_1488_1895 | 135 |
| 137 | 3300042597 | Ga0466699_166495 | Ga0466699_166495_578_985 | 135 |
| 138 | 3300042607 | Ga0466720_083290 | Ga0466720_083290_4003_4410 | 135 |
| 139 | 3300042635 | Ga0466702_036383 | Ga0466702_036383_106_513 | 135 |
| 140 | 3300002450 | JGI24695J34938_10031154 | JGI24695J34938_100311545 | 136 |
| 141 | 3300042607 | Ga0466720_033754 | Ga0466720_033754_1954_2364 | 136 |
| 142 | 3300042607 | Ga0466720_063386 | Ga0466720_063386_6144_6554 | 136 |
| 143 | 3300042607 | Ga0466720_096500 | Ga0466720_096500_11895_12305 | 136 |
| 144 | 3300042607 | Ga0466720_183807 | Ga0466720_183807_18_506 | 162 |
| 145 | 3300005201 | Ga0072941_1049837 | Ga0072941_10498372 | 187 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02472 | ExbD | Biopolymer transport protein ExbD/TolR | 35 | 160 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.44 | 0.7 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.