Protein Family IF06664

Metagenome Isolate
217 Members
55 Samples
209 Scaffolds
220.66 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_129149|Ga0466720_129149_876_1658
Length
260 aa
Sequence
MYTFPYTPYVFWNSLLLCDIILFTRVIIIMIEYVVPLNIDDRALAKASRVLEGGGLVALPTDTSWSIVCSLKSPNGVKKLRKLSGERDERHFTLLCSGISQFGELCSLDNSRFRLINRLSPGPYVFILKTLLGTEKALDIRRKEVGVRIPDHPIPLALIDTLQQPLYSITAKKTMHNDSEAFDYASDDFEEDAPGDNDSGELPPIPEDNLFEGGWELDGINGLDLILDGGEERDRVFSTILDLSGDDVKLLRQGAGAWPV

📊 Sample Types

Isolate 3.7%
Metagenome 96.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.5%
Kalotermitidae 26.4%
Unclassified 15.1%
Rhinotermitidae 7.5%
Termopsidae 5.7%
Hodotermitidae 1.9%
Blaberidae 1.9%

🌳 Taxonomy

Archaea 2
Bacteria 204
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
12 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
25 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
30 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
34 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
35 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
36 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
39 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
43 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
44 2772190975 Treponema sp. RmG30 Isolate Blaberidae
45 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
46 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
50 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_012877 3300042612 Bacteria 21632
2 Ga0466705_202035 3300042612 Bacteria 2417
3 Ga0466732_111019 3300042656 Bacteria 24226
4 Ga0466732_290720 3300042656 Bacteria 13045
5 Ga0466705_461327 3300042612 Bacteria 5128
6 Ga0466711_091584 3300042615 Bacteria 27785
7 Ga0466715_085226 3300042616 Bacteria 2095
8 Ga0466718_010630 3300042617 Bacteria 5877
9 Ga0466718_072307 3300042617 Bacteria 15384
10 Ga0466718_087950 3300042617 Bacteria 3411
11 Ga0466726_235274 3300042619 Archaea 4142
12 Ga0466728_122822 3300042620 Bacteria 4200
13 Ga0264413_102080 3300024493 Unclassified 2509
14 Ga0466692_144758 3300042591 Bacteria 2332
15 Ga0466692_175385 3300042591 Bacteria 2122
16 Ga0466691_002027 3300042593 Bacteria 5219
17 Ga0466691_008365 3300042593 Bacteria 4739
18 Ga0466694_157346 3300042594 Bacteria 1268
19 Ga0466699_003058 3300042597 Bacteria 1558
20 Ga0466703_021308 3300042636 Bacteria 6611
21 Ga0466703_386298 3300042636 Bacteria 13493
22 Ga0466703_410875 3300042636 Bacteria 3963
23 Ga0466704_085208 3300042643 Bacteria 8661
24 Ga0466708_045984 3300042652 Bacteria 6966
25 Ga0466708_307922 3300042652 Bacteria 14416
26 Ga0466706_094640 3300042599 Bacteria 1216
27 Ga0466716_094974 3300042605 Bacteria 17045
28 Ga0466716_217115 3300042605 Bacteria 1698
29 Ga0466720_001047 3300042607 Bacteria 20870
30 Ga0466720_049010 3300042607 Unclassified 4002
31 Ga0466720_129149 3300042607 Bacteria 5439
32 Ga0466720_173269 3300042607 Bacteria 1057
33 Ga0466722_265857 3300042609 Bacteria 2825
34 JGI24698J34947_10005370 3300002449 Bacteria 7028
35 JGI24698J34947_10009582 3300002449 Bacteria 5311
36 JGI24698J34947_10010833 3300002449 Bacteria 5004
37 Ga0072941_1021003 3300005201 Bacteria 6898
38 Ga0072941_1085598 3300005201 Bacteria 6398
39 Ga0074263_103435 3300005485 Bacteria 1474
40 Ga0074263_105821 3300005485 Bacteria 1600
41 Ga0466705_253546 3300042612 Bacteria 4543
42 Ga0466718_007563 3300042617 Bacteria 1231
43 Ga0466718_017962 3300042617 Bacteria 5779
44 Ga0466723_200228 3300042618 Bacteria 22251
45 Ga0466728_215055 3300042620 Bacteria 3460
46 Ga0264413_106068 3300024493 Bacteria 5198
47 Ga0466699_104106 3300042597 Unclassified 10659
48 Ga0466699_115836 3300042597 Bacteria 3915
49 Ga0466699_394117 3300042597 Unclassified 1505
50 Ga0466703_386823 3300042636 Bacteria 10527
51 Ga0466704_434890 3300042643 Bacteria 41687
52 Ga0466706_233661 3300042599 Bacteria 38591
53 Ga0466720_007150 3300042607 Bacteria 10712
54 Ga0466720_035609 3300042607 Bacteria 50299
55 Ga0466720_170704 3300042607 Bacteria 1225
56 AustNasuHG_c1004656 3300000089 Unclassified 4922
57 JGI24698J34947_10002029 3300002449 Bacteria 10795
58 JGI24698J34947_10038100 3300002449 Bacteria 2495
59 JGI24695J34938_10017531 3300002450 Bacteria 3604
60 Ga0074263_108719 3300005485 Bacteria 1478
61 Ga0466712_082988 3300042614 Bacteria 2183
62 Ga0466723_262644 3300042618 Bacteria 11089
63 Ga0123353_11497960 3300010167 Bacteria 860
64 Ga0264413_111745 3300024493 Bacteria 49890
65 Ga0264413_115268 3300024493 Bacteria 1121
66 Ga0466692_041962 3300042591 Bacteria 17048
67 Ga0466692_085849 3300042591 Bacteria 1592
68 Ga0466691_047241 3300042593 Bacteria 7287
69 Ga0466694_028369 3300042594 Bacteria 1059
70 Ga0466694_155826 3300042594 Bacteria 14964
71 Ga0466699_010118 3300042597 Bacteria 3022
72 Ga0466699_076271 3300042597 Archaea 3704
73 Ga0466729_201026 3300042621 Bacteria 1247
74 Ga0466702_092852 3300042635 Bacteria 13928
75 Ga0466702_426199 3300042635 Bacteria 12559
76 Ga0466703_247509 3300042636 Bacteria 18485
77 Ga0466727_219132 3300042655 Bacteria 7035
78 Ga0466719_118797 3300042606 Bacteria 11038
79 Ga0466719_276867 3300042606 Bacteria 13939
80 Ga0466720_013698 3300042607 Bacteria 3119
81 Ga0466720_123142 3300042607 Bacteria 2943
82 Ga0466722_058526 3300042609 Bacteria 27862
83 Ga0466698_407454 3300042610 Bacteria 1575
84 Ga0466705_061834 3300042612 Bacteria 5357
85 Ga0466732_005641 3300042656 Bacteria 25741
86 Ga0466732_162487 3300042656 Bacteria 28930
87 Ga0466718_119391 3300042617 Bacteria 1351
88 Ga0466723_017538 3300042618 Bacteria 34729
89 Ga0466726_109868 3300042619 Bacteria 1003
90 Ga0123355_10187957 3300009826 Bacteria 3050
91 Ga0123356_10010491 3300010049 Bacteria 9091
92 Ga0123356_10034178 3300010049 Bacteria 4753
93 Ga0466699_415282 3300042597 Bacteria 11126
94 Ga0466731_153093 3300042622 Bacteria 1386
95 Ga0466735_061646 3300042624 Unclassified 2225
96 Ga0466707_235449 3300042601 Bacteria 5282
97 Ga0466720_012462 3300042607 Bacteria 6396
98 Ga0466720_018898 3300042607 Bacteria 38920
99 AustNasuHG_c1005753 3300000089 Bacteria 4429
100 AustNasuHG_c1035485 3300000089 Bacteria 1313
101 JGI24702J35022_10061272 3300002462 Unclassified 2012
102 Ga0072940_1027644 3300005200 Bacteria 1724
103 Ga0466705_289833 3300042612 Bacteria 4240
104 Ga0466705_423705 3300042612 Bacteria 8774
105 Ga0466712_092811 3300042614 Bacteria 22383
106 Ga0466715_564054 3300042616 Bacteria 2928
107 Ga0466718_051728 3300042617 Bacteria 17202
108 Ga0466718_077824 3300042617 Bacteria 37727
109 Ga0466723_135272 3300042618 Bacteria 14640
110 Ga0466726_472661 3300042619 Bacteria 2336
111 Ga0123356_10002030 3300010049 Bacteria 21866
112 Ga0123356_10009147 3300010049 Bacteria 9798
113 Ga0456237_0024329 3300041968 Unclassified 827
114 Ga0466693_152830 3300042592 Bacteria 52782
115 Ga0466694_210720 3300042594 Bacteria 12727
116 Ga0466694_253294 3300042594 Bacteria 1043
117 Ga0466696_399755 3300042596 Bacteria 12463
118 Ga0466699_008293 3300042597 Bacteria 3562
119 Ga0466731_095716 3300042622 Bacteria 1663
120 Ga0466702_047507 3300042635 Bacteria 1106
121 Ga0466703_023643 3300042636 Bacteria 4774
122 Ga0466703_080816 3300042636 Bacteria 8501
123 Ga0466709_108093 3300042648 Bacteria 16869
124 Ga0466719_129188 3300042606 Bacteria 5011
125 Ga0466719_236635 3300042606 Bacteria 3208
126 Ga0466720_027918 3300042607 Bacteria 5647
127 Ga0466720_069906 3300042607 Bacteria 9086
128 Ga0466720_145465 3300042607 Unclassified 3041
129 JGI24698J34947_10001269 3300002449 Bacteria 13216
130 Ga0466705_027963 3300042612 Bacteria 2806
131 Ga0466711_487714 3300042615 Bacteria 1650
132 Ga0466718_045873 3300042617 Bacteria 2439
133 Ga0466718_102724 3300042617 Bacteria 13187
134 Ga0466723_337329 3300042618 Bacteria 2590
135 Ga0466726_048381 3300042619 Bacteria 4759
136 Ga0466728_143358 3300042620 Bacteria 14463
137 Ga0123356_10069467 3300010049 Bacteria 3303
138 Ga0123356_10131132 3300010049 Bacteria 2456
139 Ga0123356_11174690 3300010049 Bacteria 934
140 Ga0466691_093803 3300042593 Bacteria 12330
141 Ga0466691_175563 3300042593 Bacteria 5514
142 Ga0466694_291034 3300042594 Bacteria 1925
143 Ga0466699_017432 3300042597 Bacteria 5528
144 Ga0466699_208579 3300042597 Bacteria 16371
145 Ga0466702_025267 3300042635 Bacteria 2134
146 Ga0466702_200648 3300042635 Bacteria 8529
147 Ga0466703_302811 3300042636 Bacteria 16476
148 Ga0466703_398148 3300042636 Bacteria 4083
149 Ga0466704_500097 3300042643 Bacteria 7084
150 Ga0466709_050184 3300042648 Bacteria 11660
151 Ga0466727_330643 3300042655 Bacteria 1041
152 Ga0466706_258947 3300042599 Bacteria 1812
153 Ga0466707_071103 3300042601 Bacteria 1647
154 Ga0466716_441405 3300042605 Bacteria 7136
155 Ga0466719_076909 3300042606 Bacteria 12032
156 Ga0466719_330281 3300042606 Bacteria 2715
157 Ga0466722_245480 3300042609 Bacteria 5125
158 AustNasuHG_c1000108 3300000089 Bacteria 24878
159 AustNasuHG_c1001360 3300000089 Bacteria 8750
160 JGI24698J34947_10039540 3300002449 Bacteria 2441
161 JGI24695J34938_10027587 3300002450 Bacteria 2682
162 Ga0072940_1011733 3300005200 Bacteria 22116
163 Ga0074263_103137 3300005485 Bacteria 2322
164 Ga0466705_216324 3300042612 Bacteria 4027
165 Ga0466712_013613 3300042614 Bacteria 5799
166 Ga0466718_098305 3300042617 Bacteria 1643
167 Ga0466728_374247 3300042620 Bacteria 3074
168 Ga0123356_10807002 3300010049 Bacteria 1109
169 Ga0264413_100247 3300024493 Bacteria 36643
170 Ga0466690_019499 3300042590 Bacteria 5264
171 Ga0466690_271874 3300042590 Bacteria 3582
172 Ga0466699_159251 3300042597 Bacteria 2860
173 Ga0466731_150150 3300042622 Bacteria 73009
174 Ga0466702_129078 3300042635 Bacteria 2608
175 Ga0466702_213059 3300042635 Bacteria 1385
176 Ga0466704_080457 3300042643 Bacteria 7873
177 Ga0466704_379441 3300042643 Bacteria 22236
178 Ga0466708_363402 3300042652 Bacteria 22632
179 Ga0466700_133220 3300042600 Bacteria 2646
180 Ga0466707_213017 3300042601 Bacteria 2720
181 Ga0466720_029091 3300042607 Bacteria 10128
182 Ga0466722_008192 3300042609 Bacteria 9038
183 Ga0466722_161109 3300042609 Bacteria 1259
184 JGI24698J34947_10036746 3300002449 Bacteria 2549
185 JGI24699J35502_11130420 3300002509 Bacteria 5100
186 Ga0072940_1004109 3300005200 Unclassified 11881
187 Ga0072941_1000579 3300005201 Bacteria 109731
188 Ga0466732_450869 3300042656 Bacteria 3962
189 Ga0466712_207563 3300042614 Bacteria 94540
190 Ga0466711_177598 3300042615 Bacteria 5849
191 Ga0466715_564801 3300042616 Bacteria 1899
192 Ga0466718_160027 3300042617 Bacteria 1983
193 Ga0466726_047329 3300042619 Bacteria 9614
194 Ga0123356_10825144 3300010049 Bacteria 1098
195 Ga0456237_0005080 3300041968 Unclassified 2095
196 Ga0466690_333914 3300042590 Bacteria 2626
197 Ga0466692_042811 3300042591 Bacteria 2093
198 Ga0466691_070680 3300042593 Bacteria 6983
199 Ga0466694_335701 3300042594 Bacteria 3759
200 Ga0466696_213209 3300042596 Bacteria 4655
201 Ga0466699_278863 3300042597 Bacteria 2542
202 Ga0466703_233189 3300042636 Bacteria 4637
203 Ga0466704_016640 3300042643 Bacteria 4624
204 Ga0466704_437242 3300042643 Bacteria 12782
205 Ga0466717_036939 3300042604 Bacteria 2042
206 Ga0466716_091245 3300042605 Bacteria 7246
207 Ga0466720_117535 3300042607 Bacteria 20172
208 Ga0466720_204558 3300042607 Bacteria 4817
209 JGI24695J34938_10004235 3300002450 Bacteria 9522

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_135272 Ga0466723_135272_8293_8880 186
2 3300042604 Ga0466717_036939 Ga0466717_036939_1222_1830 202
3 3300042617 Ga0466718_007563 Ga0466718_007563_60_668 202
4 3300005200 Ga0072940_1027644 Ga0072940_10276443 205
5 3300042607 Ga0466720_049010 Ga0466720_049010_3220_3897 205
6 3300042607 Ga0466720_145465 Ga0466720_145465_1583_2284 205
7 3300042619 Ga0466726_472661 Ga0466726_472661_177_842 205
8 3300002509 JGI24699J35502_11130420 JGI24699J35502_111304205 206
9 3300042606 Ga0466719_330281 Ga0466719_330281_465_1145 206
10 3300042655 Ga0466727_330643 Ga0466727_330643_232_906 206
11 3300042656 Ga0466732_290720 Ga0466732_290720_1052_1717 206
12 3300042636 Ga0466703_410875 Ga0466703_410875_3012_3695 207
13 3300042606 Ga0466719_076909 Ga0466719_076909_2519_3145 208
14 3300042612 Ga0466705_202035 Ga0466705_202035_1383_2009 208
15 3300042612 Ga0466705_253546 Ga0466705_253546_2106_2789 208
16 3300042612 Ga0466705_461327 Ga0466705_461327_4416_5042 208
17 3300042643 Ga0466704_434890 Ga0466704_434890_26974_27600 208
18 3300042597 Ga0466699_394117 Ga0466699_394117_755_1420 209
19 3300042607 Ga0466720_027918 Ga0466720_027918_3713_4387 209
20 3300042622 Ga0466731_150150 Ga0466731_150150_35628_36260 210
21 3300041968 Ga0456237_0005080 Ga0456237_0005080_764_1399 211
22 3300042607 Ga0466720_018898 Ga0466720_018898_1377_2057 211
23 3300042656 Ga0466732_005641 Ga0466732_005641_20807_21442 211
24 3300024493 Ga0264413_102080 Ga0264413_1020802 212
25 3300042590 Ga0466690_271874 Ga0466690_271874_1014_1652 212
26 3300042599 Ga0466706_233661 Ga0466706_233661_20087_20725 212
27 3300042605 Ga0466716_094974 Ga0466716_094974_16100_16738 212
28 3300042606 Ga0466719_236635 Ga0466719_236635_1012_1650 212
29 3300042612 Ga0466705_423705 Ga0466705_423705_5540_6178 212
30 3300042618 Ga0466723_017538 Ga0466723_017538_6369_7007 212
31 3300042620 Ga0466728_374247 Ga0466728_374247_1574_2212 212
32 3300042643 Ga0466704_437242 Ga0466704_437242_8985_9623 212
33 3300042652 Ga0466708_307922 Ga0466708_307922_1411_2049 212
34 3300042652 Ga0466708_363402 Ga0466708_363402_18089_18727 212
35 3300042607 Ga0466720_170704 Ga0466720_170704_123_809 213
36 3300042599 Ga0466706_094640 Ga0466706_094640_252_896 214
37 3300042607 Ga0466720_029091 Ga0466720_029091_7485_8165 214
38 3300042605 Ga0466716_441405 Ga0466716_441405_2265_2912 215
39 3300042616 Ga0466715_564801 Ga0466715_564801_209_856 215
40 3300042618 Ga0466723_200228 Ga0466723_200228_3598_4245 215
41 3300042620 Ga0466728_122822 Ga0466728_122822_1280_1927 215
42 3300042620 Ga0466728_215055 Ga0466728_215055_1280_1927 215
43 3300042616 Ga0466715_564054 Ga0466715_564054_1235_1885 216
44 3300042648 Ga0466709_108093 Ga0466709_108093_13185_13835 216
45 3300041968 Ga0456237_0024329 Ga0456237_0024329_124_795 217
46 3300042599 Ga0466706_258947 Ga0466706_258947_219_872 217
47 3300042606 Ga0466719_129188 Ga0466719_129188_3217_3873 218
48 3300042636 Ga0466703_386298 Ga0466703_386298_5295_5951 218
49 3300042636 Ga0466703_386823 Ga0466703_386823_1646_2302 218
50 3300005485 Ga0074263_105821 Ga0074263_1058211 219
51 3300042612 Ga0466705_061834 Ga0466705_061834_1764_2423 219
52 3300042635 Ga0466702_025267 Ga0466702_025267_1310_1984 219
53 iso_pr_bacteria 2781125683 2781410883 219
54 3300042597 Ga0466699_115836 Ga0466699_115836_808_1470 220
55 3300042609 Ga0466722_008192 Ga0466722_008192_1386_2048 220
56 3300042636 Ga0466703_302811 Ga0466703_302811_14814_15476 220
57 iso_pr_bacteria 2781125685 2781417669 220
58 3300010049 Ga0123356_10069467 Ga0123356_100694673 221
59 3300024493 Ga0264413_100247 Ga0264413_10024724 221
60 3300024493 Ga0264413_111745 Ga0264413_11174541 221
61 3300042594 Ga0466694_155826 Ga0466694_155826_11478_12143 221
62 3300042597 Ga0466699_003058 Ga0466699_003058_760_1425 221
63 3300042597 Ga0466699_008293 Ga0466699_008293_546_1211 221
64 3300042597 Ga0466699_017432 Ga0466699_017432_2275_2940 221
65 3300042597 Ga0466699_076271 Ga0466699_076271_312_977 221
66 3300042597 Ga0466699_104106 Ga0466699_104106_4952_5617 221
67 3300042597 Ga0466699_159251 Ga0466699_159251_1235_1900 221
68 3300042597 Ga0466699_208579 Ga0466699_208579_1471_2136 221
69 3300042597 Ga0466699_415282 Ga0466699_415282_9187_9852 221
70 3300042600 Ga0466700_133220 Ga0466700_133220_302_967 221
71 3300042606 Ga0466719_276867 Ga0466719_276867_4105_4770 221
72 3300042607 Ga0466720_007150 Ga0466720_007150_854_1519 221
73 3300042607 Ga0466720_035609 Ga0466720_035609_25913_26578 221
74 3300042614 Ga0466712_013613 Ga0466712_013613_3758_4423 221
75 3300042614 Ga0466712_092811 Ga0466712_092811_6367_7032 221
76 3300042614 Ga0466712_207563 Ga0466712_207563_48566_49231 221
77 3300042615 Ga0466711_091584 Ga0466711_091584_26596_27261 221
78 3300042616 Ga0466715_085226 Ga0466715_085226_1212_1877 221
79 3300042617 Ga0466718_010630 Ga0466718_010630_3117_3782 221
80 3300042617 Ga0466718_017962 Ga0466718_017962_3894_4559 221
81 3300042617 Ga0466718_072307 Ga0466718_072307_12350_13015 221
82 3300042617 Ga0466718_087950 Ga0466718_087950_288_953 221
83 3300042617 Ga0466718_098305 Ga0466718_098305_103_768 221
84 3300042617 Ga0466718_119391 Ga0466718_119391_570_1235 221
85 3300042617 Ga0466718_160027 Ga0466718_160027_720_1385 221
86 3300042618 Ga0466723_262644 Ga0466723_262644_5682_6347 221
87 3300042619 Ga0466726_048381 Ga0466726_048381_1969_2634 221
88 3300042619 Ga0466726_235274 Ga0466726_235274_193_858 221
89 3300042635 Ga0466702_047507 Ga0466702_047507_297_962 221
90 3300042635 Ga0466702_092852 Ga0466702_092852_12523_13188 221
91 3300042643 Ga0466704_379441 Ga0466704_379441_13013_13678 221
92 3300042656 Ga0466732_111019 Ga0466732_111019_1356_2021 221
93 3300042656 Ga0466732_450869 Ga0466732_450869_2551_3216 221
94 iso_pr_bacteria 2781125631 2781267841 221
95 iso_pr_bacteria 2819992462 2819994705 221
96 iso_pr_bacteria 2820020240 2820021237 221
97 3300000089 AustNasuHG_c1001360 AustNasuHG_10013606 222
98 3300000089 AustNasuHG_c1005753 AustNasuHG_10057531 222
99 3300002449 JGI24698J34947_10001269 JGI24698J34947_100012692 222
100 3300002449 JGI24698J34947_10002029 JGI24698J34947_1000202911 222
101 3300002449 JGI24698J34947_10009582 JGI24698J34947_100095824 222
102 3300002449 JGI24698J34947_10010833 JGI24698J34947_100108336 222
103 3300002449 JGI24698J34947_10036746 JGI24698J34947_100367463 222
104 3300002449 JGI24698J34947_10038100 JGI24698J34947_100381002 222
105 3300002449 JGI24698J34947_10039540 JGI24698J34947_100395402 222
106 3300002450 JGI24695J34938_10004235 JGI24695J34938_100042354 222
107 3300002450 JGI24695J34938_10027587 JGI24695J34938_100275871 222
108 3300002462 JGI24702J35022_10061272 JGI24702J35022_100612721 222
109 3300005200 Ga0072940_1011733 Ga0072940_101173315 222
110 3300005201 Ga0072941_1000579 Ga0072941_1000579105 222
111 3300010049 Ga0123356_10131132 Ga0123356_101311322 222
112 3300024493 Ga0264413_115268 Ga0264413_1152682 222
113 3300042591 Ga0466692_041962 Ga0466692_041962_11742_12410 222
114 3300042591 Ga0466692_042811 Ga0466692_042811_433_1101 222
115 3300042591 Ga0466692_144758 Ga0466692_144758_1418_2086 222
116 3300042591 Ga0466692_175385 Ga0466692_175385_538_1206 222
117 3300042592 Ga0466693_152830 Ga0466693_152830_27417_28085 222
118 3300042594 Ga0466694_028369 Ga0466694_028369_252_920 222
119 3300042594 Ga0466694_291034 Ga0466694_291034_1073_1741 222
120 3300042594 Ga0466694_335701 Ga0466694_335701_2645_3313 222
121 3300042601 Ga0466707_213017 Ga0466707_213017_1107_1775 222
122 3300042605 Ga0466716_091245 Ga0466716_091245_2527_3195 222
123 3300042605 Ga0466716_217115 Ga0466716_217115_739_1407 222
124 3300042606 Ga0466719_118797 Ga0466719_118797_6263_6931 222
125 3300042607 Ga0466720_012462 Ga0466720_012462_4975_5667 222
126 3300042607 Ga0466720_173269 Ga0466720_173269_292_960 222
127 3300042607 Ga0466720_204558 Ga0466720_204558_3789_4457 222
128 3300042609 Ga0466722_161109 Ga0466722_161109_506_1174 222
129 3300042609 Ga0466722_245480 Ga0466722_245480_2195_2863 222
130 3300042609 Ga0466722_265857 Ga0466722_265857_2121_2789 222
131 3300042612 Ga0466705_012877 Ga0466705_012877_17988_18656 222
132 3300042612 Ga0466705_027963 Ga0466705_027963_335_1003 222
133 3300042614 Ga0466712_082988 Ga0466712_082988_161_829 222
134 3300042615 Ga0466711_177598 Ga0466711_177598_2902_3570 222
135 3300042617 Ga0466718_045873 Ga0466718_045873_186_854 222
136 3300042617 Ga0466718_077824 Ga0466718_077824_36563_37231 222
137 3300042617 Ga0466718_102724 Ga0466718_102724_9927_10595 222
138 3300042618 Ga0466723_337329 Ga0466723_337329_1184_1852 222
139 3300042619 Ga0466726_109868 Ga0466726_109868_202_870 222
140 3300042622 Ga0466731_095716 Ga0466731_095716_11_679 222
141 3300042622 Ga0466731_153093 Ga0466731_153093_189_857 222
142 3300042635 Ga0466702_200648 Ga0466702_200648_2338_3006 222
143 3300042635 Ga0466702_213059 Ga0466702_213059_80_748 222
144 3300042635 Ga0466702_426199 Ga0466702_426199_11291_11959 222
145 3300042636 Ga0466703_021308 Ga0466703_021308_3362_4030 222
146 3300042636 Ga0466703_233189 Ga0466703_233189_1901_2569 222
147 3300042636 Ga0466703_247509 Ga0466703_247509_5742_6410 222
148 3300042643 Ga0466704_080457 Ga0466704_080457_2068_2736 222
149 3300042643 Ga0466704_085208 Ga0466704_085208_5719_6387 222
150 3300042643 Ga0466704_500097 Ga0466704_500097_4057_4725 222
151 3300042648 Ga0466709_050184 Ga0466709_050184_5850_6518 222
152 3300042655 Ga0466727_219132 Ga0466727_219132_4409_5077 222
153 iso_pr_bacteria 2781125634 2781275786 222
154 3300000089 AustNasuHG_c1004656 AustNasuHG_10046567 223
155 3300002449 JGI24698J34947_10005370 JGI24698J34947_100053706 223
156 3300005200 Ga0072940_1004109 Ga0072940_10041096 223
157 3300005201 Ga0072941_1021003 Ga0072941_10210032 223
158 3300005201 Ga0072941_1085598 Ga0072941_10855981 223
159 3300009826 Ga0123355_10187957 Ga0123355_101879571 223
160 3300010049 Ga0123356_10002030 Ga0123356_1000203020 223
161 3300010049 Ga0123356_10010491 Ga0123356_100104915 223
162 3300010167 Ga0123353_11497960 Ga0123353_114979601 223
163 3300042590 Ga0466690_333914 Ga0466690_333914_1867_2538 223
164 3300042591 Ga0466692_085849 Ga0466692_085849_91_762 223
165 3300042593 Ga0466691_047241 Ga0466691_047241_4546_5217 223
166 3300042593 Ga0466691_093803 Ga0466691_093803_4256_4927 223
167 3300042593 Ga0466691_175563 Ga0466691_175563_1226_1897 223
168 3300042596 Ga0466696_213209 Ga0466696_213209_369_1040 223
169 3300042597 Ga0466699_010118 Ga0466699_010118_30_701 223
170 3300042607 Ga0466720_001047 Ga0466720_001047_15099_15770 223
171 3300042607 Ga0466720_069906 Ga0466720_069906_6726_7397 223
172 3300042609 Ga0466722_058526 Ga0466722_058526_5335_6006 223
173 3300042612 Ga0466705_289833 Ga0466705_289833_2032_2703 223
174 3300042619 Ga0466726_047329 Ga0466726_047329_1624_2295 223
175 3300042636 Ga0466703_023643 Ga0466703_023643_631_1302 223
176 3300042636 Ga0466703_398148 Ga0466703_398148_2067_2738 223
177 3300042643 Ga0466704_016640 Ga0466704_016640_2413_3084 223
178 3300042656 Ga0466732_162487 Ga0466732_162487_21234_21905 223
179 iso_pr_bacteria 2772190975 2773721714 223
180 3300000089 AustNasuHG_c1000108 AustNasuHG_100010816 224
181 3300042593 Ga0466691_008365 Ga0466691_008365_1763_2437 224
182 3300042601 Ga0466707_235449 Ga0466707_235449_1684_2358 224
183 3300042617 Ga0466718_051728 Ga0466718_051728_12016_12690 224
184 3300005485 Ga0074263_103137 Ga0074263_1031372 225
185 3300042597 Ga0466699_278863 Ga0466699_278863_1763_2440 225
186 3300042601 Ga0466707_071103 Ga0466707_071103_504_1181 225
187 3300042607 Ga0466720_013698 Ga0466720_013698_796_1473 225
188 3300042612 Ga0466705_216324 Ga0466705_216324_1558_2235 225
189 3300010049 Ga0123356_10009147 Ga0123356_100091478 226
190 3300010049 Ga0123356_11174690 Ga0123356_111746902 226
191 3300042596 Ga0466696_399755 Ga0466696_399755_5570_6250 226
192 3300042607 Ga0466720_123142 Ga0466720_123142_2151_2831 226
193 3300042615 Ga0466711_487714 Ga0466711_487714_503_1183 226
194 3300042593 Ga0466691_002027 Ga0466691_002027_2994_3677 227
195 3300042624 Ga0466735_061646 Ga0466735_061646_285_968 227
196 3300002450 JGI24695J34938_10017531 JGI24695J34938_100175312 228
197 3300005485 Ga0074263_108719 Ga0074263_1087192 228
198 3300042635 Ga0466702_129078 Ga0466702_129078_1715_2401 228
199 3300042636 Ga0466703_080816 Ga0466703_080816_2626_3312 228
200 3300042652 Ga0466708_045984 Ga0466708_045984_2440_3126 228
201 3300042594 Ga0466694_210720 Ga0466694_210720_7788_8477 229
202 3300042594 Ga0466694_253294 Ga0466694_253294_121_813 230
203 3300010049 Ga0123356_10034178 Ga0123356_100341783 231
204 3300042590 Ga0466690_019499 Ga0466690_019499_2089_2784 231
205 3300042593 Ga0466691_070680 Ga0466691_070680_2155_2850 231
206 3300042594 Ga0466694_157346 Ga0466694_157346_76_771 231
207 3300042610 Ga0466698_407454 Ga0466698_407454_688_1383 231
208 3300010049 Ga0123356_10807002 Ga0123356_108070021 232
209 3300042620 Ga0466728_143358 Ga0466728_143358_7218_7916 232
210 3300000089 AustNasuHG_c1035485 AustNasuHG_10354852 233
211 3300010049 Ga0123356_10825144 Ga0123356_108251442 234
212 3300024493 Ga0264413_106068 Ga0264413_1060682 235
213 3300005485 Ga0074263_103435 Ga0074263_1034352 237
214 iso_pr_bacteria 2781125643 2781293223 238
215 3300042621 Ga0466729_201026 Ga0466729_201026_145_867 240
216 3300042607 Ga0466720_117535 Ga0466720_117535_12220_12963 247
217 3300042607 Ga0466720_129149 Ga0466720_129149_876_1658 260

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01300 Sua5_yciO_yrdC Telomere recombination 50 191 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01300 GO:0003725 double-stranded RNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.