Protein Family IF06661

Metagenome Isolate
181 Members
60 Samples
167 Scaffolds
341.27 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_115891|Ga0466720_115891_117_1370
Length
400 aa
Sequence
LTRGNGCVYPQLFSTIYKLTQYGGRDNTLFLAHSLFFCYFLDMEKFADEAIIEVSSGSGGNGCVAFRREKYIPLGGPSGGXXGRGGDVVFTVRRNVRTLAHLRYKHTFKAKNGQDGRGSGCYGKNGEDIVIPLPPGSIVREAETGELVKDFSEEARDKDDFVFLKGGNGGWGNIHFKSSVNQAPRKALPGQPGQTVQLKIELHIMADIGLVGFPNAGKSSLLDRFTNARPKIAAYPFTTKIPNLGVLTVGDSNDTGGRDVIIADIPGLIEGASQGAGLGIRFLKHISRTSALAFLIDLSDANYLSAFDVLQQELASFSPELVQKKRLLVGTKTDLPETEGRLAELAAKYPNEKVFGISVFSGEGIKELALEFLRLADDNQALESKQRKGLSGEAALEVQA

📊 Sample Types

Isolate 7.7%
Metagenome 92.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.9%
Unclassified 25.9%
Kalotermitidae 24.1%
Rhinotermitidae 5.2%
Termopsidae 5.2%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 177
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
16 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
17 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
18 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
19 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
33 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
34 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
40 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
41 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
42 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
44 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
45 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
46 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
47 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
53 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
54 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
55 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
56 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
57 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
58 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
59 650716102 Treponema primitia ZAS-2 Isolate Unclassified
60 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_011324 3300042656 Bacteria 3888
2 Ga0466713_036587 3300042602 Unclassified 4055
3 Ga0466720_023187 3300042607 Bacteria 4300
4 Ga0466720_093607 3300042607 Bacteria 30455
5 Ga0466720_209844 3300042607 Bacteria 24188
6 Ga0466722_251251 3300042609 Bacteria 3594
7 Ga0123356_10000673 3300010049 Bacteria 37817
8 Ga0123356_10383748 3300010049 Bacteria 1538
9 Ga0264413_110888 3300024493 Bacteria 2751
10 Ga0466690_423186 3300042590 Bacteria 1946
11 Ga0466694_131161 3300042594 Bacteria 1333
12 Ga0466696_256157 3300042596 Bacteria 36381
13 Ga0466731_101169 3300042622 Bacteria 2584
14 Ga0466702_347596 3300042635 Bacteria 3129
15 Ga0466727_082289 3300042655 Bacteria 8197
16 Ga0466712_013410 3300042614 Bacteria 3609
17 Ga0466712_065835 3300042614 Bacteria 6561
18 Ga0466723_069830 3300042618 Bacteria 59394
19 Ga0466723_228042 3300042618 Bacteria 7274
20 AustNasuHG_c1017156 3300000089 Bacteria 2412
21 JGI24698J34947_10004794 3300002449 Bacteria 7395
22 JGI24695J34938_10000517 3300002450 Bacteria 37577
23 JGI24695J34938_10017765 3300002450 Bacteria 3573
24 Ga0466713_147757 3300042602 Bacteria 6953
25 Ga0466716_330236 3300042605 Bacteria 1766
26 Ga0466720_006242 3300042607 Bacteria 11760
27 Ga0466720_027935 3300042607 Bacteria 23895
28 Ga0466720_100472 3300042607 Bacteria 1454
29 Ga0466720_157778 3300042607 Bacteria 10739
30 Ga0466722_108310 3300042609 Bacteria 20847
31 Ga0466692_083289 3300042591 Bacteria 3812
32 Ga0466696_027027 3300042596 Bacteria 1109
33 Ga0466729_234233 3300042621 Bacteria 2697
34 Ga0466727_332593 3300042655 Bacteria 3107
35 Ga0466718_041146 3300042617 Bacteria 3817
36 Ga0466723_085936 3300042618 Bacteria 4250
37 JGI24700J35501_10930500 3300002508 Bacteria 14760
38 Ga0072940_1006184 3300005200 Bacteria 11783
39 Ga0072940_1232177 3300005200 Bacteria 3875
40 Ga0074263_101998 3300005485 Bacteria 2820
41 Ga0074263_104786 3300005485 Bacteria 2114
42 Ga0466705_197661 3300042612 Bacteria 2580
43 Ga0466700_351950 3300042600 Bacteria 4533
44 Ga0466720_001820 3300042607 Bacteria 3499
45 Ga0466722_083402 3300042609 Bacteria 1568
46 Ga0466698_413354 3300042610 Bacteria 3538
47 Ga0466657_230430 3300042582 Bacteria 2497
48 Ga0466690_408771 3300042590 Bacteria 5360
49 Ga0466692_045234 3300042591 Bacteria 21389
50 Ga0466692_095794 3300042591 Bacteria 24513
51 Ga0466694_166314 3300042594 Bacteria 23774
52 Ga0466699_144187 3300042597 Bacteria 18805
53 Ga0466731_125974 3300042622 Unclassified 5967
54 Ga0466709_113537 3300042648 Bacteria 10119
55 Ga0466708_285465 3300042652 Bacteria 1747
56 Ga0466711_017592 3300042615 Bacteria 12864
57 Ga0466711_057929 3300042615 Bacteria 2335
58 Ga0466718_023428 3300042617 Bacteria 58531
59 Ga0466718_137930 3300042617 Bacteria 1042
60 JGI24695J34938_10006111 3300002450 Bacteria 7329
61 JGI24702J35022_10002303 3300002462 Bacteria 11706
62 Ga0466719_089683 3300042606 Bacteria 7170
63 Ga0466720_023427 3300042607 Bacteria 1524
64 Ga0466720_058276 3300042607 Bacteria 42688
65 Ga0466722_010680 3300042609 Bacteria 5373
66 Ga0466722_048209 3300042609 Bacteria 4823
67 Ga0466722_227399 3300042609 Bacteria 1493
68 Ga0466692_142165 3300042591 Bacteria 18180
69 Ga0466694_028560 3300042594 Bacteria 27113
70 Ga0466703_231460 3300042636 Bacteria 5029
71 Ga0466704_079747 3300042643 Bacteria 12802
72 Ga0466704_114284 3300042643 Bacteria 5903
73 Ga0466727_022593 3300042655 Bacteria 6490
74 Ga0466727_170314 3300042655 Bacteria 2400
75 Ga0466712_033689 3300042614 Bacteria 1929
76 Ga0466718_159704 3300042617 Bacteria 1608
77 Ga0466726_124238 3300042619 Bacteria 4310
78 Ga0466726_137107 3300042619 Bacteria 4573
79 Ga0466728_034112 3300042620 Bacteria 27725
80 JGI24698J34947_10082683 3300002449 Bacteria 1500
81 Ga0072940_1466100 3300005200 Bacteria 2156
82 Ga0466732_116533 3300042656 Bacteria 17693
83 Ga0466732_242928 3300042656 Unclassified 1535
84 Ga0466700_160256 3300042600 Bacteria 3692
85 Ga0466719_047594 3300042606 Bacteria 10214
86 Ga0466720_023375 3300042607 Unclassified 14601
87 Ga0466720_026260 3300042607 Bacteria 25590
88 Ga0466698_318181 3300042610 Bacteria 1503
89 Ga0123356_10000865 3300010049 Bacteria 33632
90 Ga0123356_10356910 3300010049 Bacteria 1587
91 Ga0123353_10015338 3300010167 Bacteria 11124
92 Ga0123353_10053328 3300010167 Bacteria 6463
93 Ga0466691_027110 3300042593 Bacteria 2827
94 Ga0466694_081297 3300042594 Bacteria 3718
95 Ga0466703_132099 3300042636 Bacteria 29234
96 Ga0466708_281540 3300042652 Bacteria 20650
97 Ga0466712_154031 3300042614 Bacteria 14619
98 Ga0466715_080016 3300042616 Bacteria 22104
99 Ga0466715_251035 3300042616 Bacteria 6415
100 Ga0466715_336800 3300042616 Bacteria 1775
101 Ga0466715_413563 3300042616 Bacteria 7035
102 Ga0466715_472351 3300042616 Bacteria 8767
103 Ga0466715_514149 3300042616 Bacteria 8777
104 Ga0466726_042391 3300042619 Bacteria 39221
105 AustNasuHG_c1001425 3300000089 Bacteria 8552
106 JGI24695J34938_10004857 3300002450 Bacteria 8622
107 JGI24702J35022_10001485 3300002462 Bacteria 14553
108 Ga0072941_1000679 3300005201 Bacteria 14735
109 Ga0072941_1023286 3300005201 Bacteria 7884
110 Ga0466705_006274 3300042612 Bacteria 6742
111 Ga0466720_115891 3300042607 Bacteria 4677
112 Ga0466722_022875 3300042609 Bacteria 6212
113 Ga0466722_040150 3300042609 Bacteria 5220
114 Ga0123356_10067674 3300010049 Bacteria 3345
115 Ga0123356_10295719 3300010049 Bacteria 1722
116 Ga0123354_10150541 3300010882 Bacteria 2821
117 Ga0466693_154548 3300042592 Bacteria 1473
118 Ga0466694_078502 3300042594 Bacteria 33638
119 Ga0466699_146529 3300042597 Bacteria 18494
120 Ga0466699_153073 3300042597 Bacteria 21357
121 Ga0466704_394489 3300042643 Bacteria 2333
122 Ga0466708_099906 3300042652 Bacteria 39915
123 Ga0466712_137759 3300042614 Bacteria 3643
124 Ga0466715_134923 3300042616 Bacteria 9396
125 AustNasuHG_c1000379 3300000089 Bacteria 15425
126 Ga0068305_10083630 3300005083 Bacteria 2641
127 Ga0466705_039391 3300042612 Bacteria 23770
128 Ga0466732_453554 3300042656 Bacteria 3075
129 Ga0466706_180648 3300042599 Bacteria 2391
130 Ga0466700_124952 3300042600 Bacteria 1453
131 Ga0466720_021273 3300042607 Bacteria 41620
132 Ga0466722_213869 3300042609 Bacteria 8503
133 Ga0123356_10690440 3300010049 Bacteria 1189
134 Ga0123353_10305841 3300010167 Bacteria 2423
135 Ga0466692_099580 3300042591 Bacteria 1127
136 Ga0466699_056422 3300042597 Bacteria 6374
137 Ga0466699_369814 3300042597 Bacteria 1964
138 Ga0466735_025071 3300042624 Bacteria 13306
139 Ga0466735_223886 3300042624 Bacteria 1903
140 Ga0466712_187946 3300042614 Bacteria 1958
141 Ga0466711_050128 3300042615 Bacteria 17464
142 Ga0466718_035208 3300042617 Bacteria 1513
143 Ga0466726_340546 3300042619 Bacteria 2182
144 Ga0466728_293951 3300042620 Bacteria 1902
145 JGI24698J34947_10006644 3300002449 Bacteria 6351
146 JGI24698J34947_10008296 3300002449 Bacteria 5695
147 JGI24695J34938_10065496 3300002450 Bacteria 1534
148 Ga0466700_452930 3300042600 Bacteria 3333
149 Ga0466719_225394 3300042606 Bacteria 70315
150 Ga0466720_076308 3300042607 Bacteria 13359
151 Ga0466698_405442 3300042610 Bacteria 1430
152 Ga0466698_449792 3300042610 Bacteria 7889
153 Ga0123356_10001174 3300010049 Bacteria 28989
154 Ga0123353_10224144 3300010167 Bacteria 2937
155 Ga0466692_146154 3300042591 Bacteria 2172
156 Ga0466691_085140 3300042593 Bacteria 8670
157 Ga0466694_309425 3300042594 Bacteria 7720
158 Ga0466699_117382 3300042597 Bacteria 7366
159 Ga0466699_206786 3300042597 Bacteria 2770
160 Ga0466699_364451 3300042597 Bacteria 5728
161 Ga0466731_033473 3300042622 Bacteria 1799
162 Ga0466735_066995 3300042624 Bacteria 3011
163 Ga0466703_320941 3300042636 Bacteria 1152
164 Ga0466704_286649 3300042643 Bacteria 10797
165 Ga0466708_305208 3300042652 Bacteria 9462
166 Ga0466727_210330 3300042655 Bacteria 1211
167 Ga0466718_054074 3300042617 Bacteria 3822

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002462 JGI24702J35022_10002303 JGI24702J35022_100023038 264
2 3300042614 Ga0466712_187946 Ga0466712_187946_1081_1935 284
3 3300042596 Ga0466696_027027 Ga0466696_027027_56_919 287
4 3300042615 Ga0466711_017592 Ga0466711_017592_1751_2626 291
5 3300042594 Ga0466694_081297 Ga0466694_081297_370_1248 292
6 3300042597 Ga0466699_369814 Ga0466699_369814_191_1078 295
7 3300042617 Ga0466718_137930 Ga0466718_137930_37_930 297
8 3300042624 Ga0466735_025071 Ga0466735_025071_2324_3313 310
9 3300042590 Ga0466690_423186 Ga0466690_423186_856_1797 313
10 3300042620 Ga0466728_293951 Ga0466728_293951_459_1442 319
11 3300042648 Ga0466709_113537 Ga0466709_113537_5650_6768 322
12 3300042655 Ga0466727_082289 Ga0466727_082289_6571_7602 323
13 3300042643 Ga0466704_394489 Ga0466704_394489_267_1385 324
14 3300042615 Ga0466711_050128 Ga0466711_050128_9514_10491 325
15 3300010049 Ga0123356_10000673 Ga0123356_1000067320 326
16 3300042602 Ga0466713_036587 Ga0466713_036587_2862_3908 326
17 3300042655 Ga0466727_170314 Ga0466727_170314_1001_2038 326
18 3300042594 Ga0466694_309425 Ga0466694_309425_854_1864 327
19 3300042609 Ga0466722_040150 Ga0466722_040150_964_1977 327
20 3300042656 Ga0466732_242928 Ga0466732_242928_65_1174 327
21 3300002450 JGI24695J34938_10065496 JGI24695J34938_100654962 328
22 3300042591 Ga0466692_099580 Ga0466692_099580_62_1072 328
23 3300042607 Ga0466720_023375 Ga0466720_023375_8614_9621 328
24 3300042607 Ga0466720_157778 Ga0466720_157778_3867_4874 328
25 3300042609 Ga0466722_213869 Ga0466722_213869_4884_5870 328
26 3300042616 Ga0466715_080016 Ga0466715_080016_1829_2875 328
27 3300005200 Ga0072940_1466100 Ga0072940_14661002 329
28 3300010049 Ga0123356_10001174 Ga0123356_1000117417 329
29 3300010049 Ga0123356_10690440 Ga0123356_106904402 329
30 3300042594 Ga0466694_131161 Ga0466694_131161_69_1106 329
31 3300042609 Ga0466722_048209 Ga0466722_048209_532_1521 329
32 iso_pr_bacteria 2781125641 2781290623 329
33 iso_pr_bacteria 2781125641 2781291050 329
34 3300002449 JGI24698J34947_10082683 JGI24698J34947_100826832 330
35 3300042636 Ga0466703_132099 Ga0466703_132099_7565_8557 330
36 3300042652 Ga0466708_285465 Ga0466708_285465_269_1300 330
37 3300005200 Ga0072940_1232177 Ga0072940_12321772 331
38 3300042655 Ga0466727_332593 Ga0466727_332593_1946_2965 331
39 3300042592 Ga0466693_154548 Ga0466693_154548_161_1177 332
40 3300042607 Ga0466720_023427 Ga0466720_023427_434_1453 332
41 3300042609 Ga0466722_251251 Ga0466722_251251_2012_3010 332
42 3300042618 Ga0466723_069830 Ga0466723_069830_27022_28038 332
43 3300042621 Ga0466729_234233 Ga0466729_234233_95_1114 332
44 3300042622 Ga0466731_101169 Ga0466731_101169_1444_2469 332
45 3300042655 Ga0466727_210330 Ga0466727_210330_164_1183 332
46 3300042590 Ga0466690_408771 Ga0466690_408771_562_1611 333
47 3300042594 Ga0466694_028560 Ga0466694_028560_19917_20939 333
48 3300042597 Ga0466699_364451 Ga0466699_364451_1943_2944 333
49 3300042600 Ga0466700_351950 Ga0466700_351950_3204_4274 333
50 3300042612 Ga0466705_197661 Ga0466705_197661_944_1975 333
51 3300042620 Ga0466728_034112 Ga0466728_034112_2240_3274 333
52 3300010049 Ga0123356_10356910 Ga0123356_103569102 334
53 3300042596 Ga0466696_256157 Ga0466696_256157_10479_11507 334
54 3300042605 Ga0466716_330236 Ga0466716_330236_337_1386 334
55 3300042609 Ga0466722_227399 Ga0466722_227399_291_1295 334
56 3300042614 Ga0466712_013410 Ga0466712_013410_1747_2751 334
57 3300042616 Ga0466715_134923 Ga0466715_134923_5609_6640 334
58 3300042616 Ga0466715_251035 Ga0466715_251035_4726_5799 334
59 3300002449 JGI24698J34947_10006644 JGI24698J34947_100066442 335
60 3300010167 Ga0123353_10015338 Ga0123353_100153385 335
61 3300010882 Ga0123354_10150541 Ga0123354_101505411 335
62 3300042594 Ga0466694_166314 Ga0466694_166314_3159_4220 335
63 3300002450 JGI24695J34938_10000517 JGI24695J34938_1000051718 336
64 3300042591 Ga0466692_083289 Ga0466692_083289_2457_3491 336
65 3300042597 Ga0466699_146529 Ga0466699_146529_2488_3513 336
66 3300042599 Ga0466706_180648 Ga0466706_180648_301_1311 336
67 3300042600 Ga0466700_160256 Ga0466700_160256_597_1625 336
68 3300042606 Ga0466719_047594 Ga0466719_047594_1373_2404 336
69 3300042616 Ga0466715_413563 Ga0466715_413563_4483_5493 336
70 3300042619 Ga0466726_340546 Ga0466726_340546_112_1122 336
71 3300005201 Ga0072941_1023286 Ga0072941_10232862 337
72 3300024493 Ga0264413_110888 Ga0264413_1108883 337
73 3300042593 Ga0466691_027110 Ga0466691_027110_423_1589 337
74 3300042609 Ga0466722_083402 Ga0466722_083402_352_1365 337
75 3300042614 Ga0466712_033689 Ga0466712_033689_172_1185 337
76 3300042614 Ga0466712_137759 Ga0466712_137759_63_1076 337
77 3300042619 Ga0466726_137107 Ga0466726_137107_2776_3810 337
78 3300002450 JGI24695J34938_10017765 JGI24695J34938_100177653 338
79 3300042582 Ga0466657_230430 Ga0466657_230430_509_1525 338
80 3300042597 Ga0466699_144187 Ga0466699_144187_9228_10265 338
81 3300042597 Ga0466699_153073 Ga0466699_153073_9637_10710 338
82 3300042609 Ga0466722_108310 Ga0466722_108310_7515_8555 338
83 3300042614 Ga0466712_154031 Ga0466712_154031_11489_12556 338
84 3300002449 JGI24698J34947_10008296 JGI24698J34947_100082965 339
85 3300042600 Ga0466700_124952 Ga0466700_124952_196_1215 339
86 3300042607 Ga0466720_023187 Ga0466720_023187_28_1125 339
87 3300042607 Ga0466720_026260 Ga0466720_026260_24151_25170 339
88 3300042617 Ga0466718_023428 Ga0466718_023428_26164_27183 339
89 3300042619 Ga0466726_042391 Ga0466726_042391_25660_26703 339
90 3300042635 Ga0466702_347596 Ga0466702_347596_1791_2810 339
91 3300042656 Ga0466732_453554 Ga0466732_453554_94_1170 339
92 3300010049 Ga0123356_10000865 Ga0123356_100008657 340
93 3300042602 Ga0466713_147757 Ga0466713_147757_1320_2372 340
94 3300042617 Ga0466718_035208 Ga0466718_035208_123_1163 340
95 3300042618 Ga0466723_085936 Ga0466723_085936_900_1967 340
96 3300000089 AustNasuHG_c1000379 AustNasuHG_100037912 341
97 3300002462 JGI24702J35022_10001485 JGI24702J35022_1000148511 341
98 3300010049 Ga0123356_10383748 Ga0123356_103837481 341
99 3300042594 Ga0466694_078502 Ga0466694_078502_2988_4037 341
100 3300042610 Ga0466698_413354 Ga0466698_413354_118_1164 341
101 3300042614 Ga0466712_065835 Ga0466712_065835_1181_2206 341
102 3300042616 Ga0466715_336800 Ga0466715_336800_255_1304 341
103 iso_pr_bacteria 2781125693 2781434489 341
104 3300002449 JGI24698J34947_10004794 JGI24698J34947_100047945 342
105 3300010167 Ga0123353_10305841 Ga0123353_103058411 342
106 3300042607 Ga0466720_209844 Ga0466720_209844_22440_23489 342
107 3300042610 Ga0466698_449792 Ga0466698_449792_2597_3625 342
108 3300010167 Ga0123353_10224144 Ga0123353_102241445 343
109 3300042591 Ga0466692_142165 Ga0466692_142165_6344_7576 343
110 3300042591 Ga0466692_146154 Ga0466692_146154_1002_2033 343
111 3300042607 Ga0466720_058276 Ga0466720_058276_34128_35180 343
112 3300042652 Ga0466708_099906 Ga0466708_099906_31144_32175 343
113 3300042652 Ga0466708_281540 Ga0466708_281540_18524_19579 343
114 3300042610 Ga0466698_405442 Ga0466698_405442_272_1306 344
115 3300042615 Ga0466711_057929 Ga0466711_057929_268_1302 344
116 3300042597 Ga0466699_056422 Ga0466699_056422_4935_5972 345
117 3300042597 Ga0466699_117382 Ga0466699_117382_1527_2564 345
118 3300042606 Ga0466719_225394 Ga0466719_225394_32864_33925 345
119 3300042656 Ga0466732_011324 Ga0466732_011324_2430_3485 345
120 iso_pr_bacteria 2781125664 2781339086 345
121 3300000089 AustNasuHG_c1017156 AustNasuHG_10171562 346
122 3300042617 Ga0466718_159704 Ga0466718_159704_166_1314 346
123 3300042622 Ga0466731_033473 Ga0466731_033473_668_1759 346
124 3300010049 Ga0123356_10295719 Ga0123356_102957192 347
125 3300042616 Ga0466715_472351 Ga0466715_472351_621_1664 347
126 3300042617 Ga0466718_054074 Ga0466718_054074_1545_2648 347
127 3300042591 Ga0466692_045234 Ga0466692_045234_6069_7181 348
128 3300042607 Ga0466720_001820 Ga0466720_001820_2250_3317 348
129 3300042593 Ga0466691_085140 Ga0466691_085140_3499_4656 349
130 3300042600 Ga0466700_452930 Ga0466700_452930_2160_3233 349
131 3300042607 Ga0466720_076308 Ga0466720_076308_268_1317 349
132 3300042607 Ga0466720_100472 Ga0466720_100472_117_1166 349
133 3300042624 Ga0466735_223886 Ga0466735_223886_417_1466 349
134 iso_pr_bacteria 650716102 650881392 349
135 3300042622 Ga0466731_125974 Ga0466731_125974_3380_4489 350
136 iso_pr_bacteria 2772190978 2773731502 350
137 3300010049 Ga0123356_10067674 Ga0123356_100676742 351
138 3300042607 Ga0466720_093607 Ga0466720_093607_9863_10939 351
139 3300042610 Ga0466698_318181 Ga0466698_318181_10_1086 351
140 3300005485 Ga0074263_104786 Ga0074263_1047862 352
141 3300010167 Ga0123353_10053328 Ga0123353_100533286 352
142 3300042609 Ga0466722_010680 Ga0466722_010680_206_1264 352
143 3300042643 Ga0466704_079747 Ga0466704_079747_3383_4441 352
144 3300005201 Ga0072941_1000679 Ga0072941_100067913 353
145 3300042612 Ga0466705_039391 Ga0466705_039391_4948_6009 353
146 3300002450 JGI24695J34938_10006111 JGI24695J34938_100061111 354
147 3300042616 Ga0466715_514149 Ga0466715_514149_7439_8521 354
148 3300042636 Ga0466703_320941 Ga0466703_320941_47_1138 354
149 3300042643 Ga0466704_286649 Ga0466704_286649_8318_9409 354
150 3300042607 Ga0466720_021273 Ga0466720_021273_37357_38445 355
151 3300042624 Ga0466735_066995 Ga0466735_066995_161_1231 356
152 3300042636 Ga0466703_231460 Ga0466703_231460_1432_2502 356
153 iso_pr_bacteria 2781125646 2781301686 356
154 3300042591 Ga0466692_095794 Ga0466692_095794_12282_13379 357
155 3300042655 Ga0466727_022593 Ga0466727_022593_3053_4126 357
156 3300042656 Ga0466732_116533 Ga0466732_116533_13634_14731 357
157 3300002508 JGI24700J35501_10930500 JGI24700J35501_109305006 358
158 3300042606 Ga0466719_089683 Ga0466719_089683_369_1460 358
159 3300042619 Ga0466726_124238 Ga0466726_124238_1935_3038 359
160 3300000089 AustNasuHG_c1001425 AustNasuHG_10014254 361
161 3300042612 Ga0466705_006274 Ga0466705_006274_2674_3759 361
162 3300042643 Ga0466704_114284 Ga0466704_114284_3550_4635 361
163 iso_pr_bacteria 2781125633 2781273200 361
164 3300005485 Ga0074263_101998 Ga0074263_1019982 362
165 3300042597 Ga0466699_206786 Ga0466699_206786_1007_2116 363
166 iso_pr_bacteria 2781125652 2781312261 363
167 iso_pr_bacteria 2819992462 2819994085 366
168 iso_pr_bacteria 2820020240 2820020440 366
169 3300042652 Ga0466708_305208 Ga0466708_305208_1993_3114 367
170 3300002450 JGI24695J34938_10004857 JGI24695J34938_100048576 371
171 3300042618 Ga0466723_228042 Ga0466723_228042_5107_6264 372
172 iso_pr_bacteria 2781125640 2781288514 372
173 3300042607 Ga0466720_006242 Ga0466720_006242_9383_10528 374
174 iso_pr_bacteria 2819994798 2819996851 374
175 3300005083 Ga0068305_10083630 Ga0068305_100836301 375
176 3300042617 Ga0466718_041146 Ga0466718_041146_333_1502 379
177 3300005200 Ga0072940_1006184 Ga0072940_10061848 382
178 3300042609 Ga0466722_022875 Ga0466722_022875_449_1675 389
179 3300042607 Ga0466720_027935 Ga0466720_027935_1306_2505 392
180 iso_pr_bacteria 2781125687 2781422115 395
181 3300042607 Ga0466720_115891 Ga0466720_115891_117_1370 400

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01018 GTP1_OBG GTP1/OBG 48 203 0.97
PF01926 MMR_HSR1 50S ribosome-binding GTPase 208 330 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01926 GO:0005525 GTP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.58 0.65 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.