Protein Family IF06656

Metagenome Metatranscriptome Isolate
174 Members
48 Samples
155 Scaffolds
143.32 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_113267|Ga0466720_113267_1232_1750
Length
172 aa
Sequence
MGSVEVQAGGGQKYRLAHLTLFTFLGHISKMNTVFVKPASVERKWYVIDAEGKVMGRVAAKVASIVRGKNKAIFAPHQEMGDYVVVINADKVNVTGRKTQQKMYYRHSGYVGGLKAITFEKLIARHPTQPLENAIKGMLPKGPLGRKLAKNAKIYAGAAHPHAAQNPTAIDL

📊 Sample Types

Isolate 10.9%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 55.6%
Unclassified 42.2%
Rhinotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
7 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
8 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
9 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
10 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
21 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
22 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
23 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
24 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
25 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
26 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
27 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
28 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
29 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
30 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
31 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
32 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
33 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
34 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
35 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
36 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
37 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
40 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
41 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
42 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
43 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
44 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
47 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
48 3300021218 Termite gut microbial communities from nest from French Guiana - FG16_L2_4 mRNA SA Metatranscriptome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466720_003412 3300042607 Unclassified 1056
2 Ga0466720_014626 3300042607 Bacteria 80288
3 Ga0466698_219696 3300042610 Bacteria 1845
4 Ga0123356_10004155 3300010049 Bacteria 15027
5 Ga0123356_10105104 3300010049 Bacteria 2716
6 Ga0123356_10189988 3300010049 Bacteria 2084
7 Ga0123356_10541768 3300010049 Bacteria 1324
8 Ga0466712_146184 3300042614 Bacteria 1713
9 Ga0466718_009636 3300042617 Bacteria 7626
10 Ga0466718_096010 3300042617 Unclassified 3542
11 Ga0466702_044195 3300042635 Bacteria 15638
12 Ga0466702_315454 3300042635 Bacteria 5696
13 AustNasuHG_c1001696 3300000089 Bacteria 7953
14 AustNasuHG_c1042995 3300000089 Bacteria 1067
15 FAAS_10006681 3300001880 Unclassified 991
16 JGI24695J34938_10010283 3300002450 Unclassified 5138
17 JGI24695J34938_10031240 3300002450 Bacteria 2473
18 JGI24695J34938_10065738 3300002450 Bacteria 1531
19 JGI24695J34938_10069158 3300002450 Bacteria 1481
20 JGI24695J34938_10248560 3300002450 Bacteria 754
21 Ga0466732_102796 3300042656 Bacteria 1715
22 Ga0466720_152084 3300042607 Bacteria 11962
23 Ga0466721_080676 3300042608 Bacteria 47264
24 Ga0123356_10001758 3300010049 Bacteria 23601
25 Ga0123356_11696822 3300010049 Bacteria 784
26 Ga0123353_10798431 3300010167 Unclassified 1304
27 Ga0466656_383391 3300042550 Bacteria 1096
28 Ga0466694_042247 3300042594 Bacteria 35764
29 Ga0466699_006172 3300042597 Bacteria 1456
30 Ga0466699_191763 3300042597 Bacteria 1146
31 Ga0466699_439515 3300042597 Bacteria 1886
32 Ga0466731_353475 3300042622 Bacteria 6886
33 Ga0466731_412863 3300042622 Bacteria 1408
34 Ga0466702_120851 3300042635 Bacteria 1486
35 Ga0466702_375699 3300042635 Bacteria 1594
36 FAAS_10006615 3300001880 Bacteria 788
37 JGI24695J34938_10011579 3300002450 Bacteria 4742
38 JGI24695J34938_10019172 3300002450 Bacteria 3398
39 Ga0466732_130011 3300042656 Bacteria 1791
40 Ga0466720_068836 3300042607 Bacteria 9291
41 Ga0466720_109571 3300042607 Bacteria 11688
42 Ga0466721_293255 3300042608 Bacteria 1972
43 Ga0466722_077441 3300042609 Bacteria 4020
44 Ga0466722_222135 3300042609 Bacteria 12545
45 Ga0123356_12707820 3300010049 Bacteria 621
46 Ga0123353_10394946 3300010167 Bacteria 2061
47 Ga0466712_001453 3300042614 Bacteria 11752
48 Ga0466712_030929 3300042614 Bacteria 4807
49 Ga0466712_277071 3300042614 Bacteria 19775
50 Ga0466712_321597 3300042614 Bacteria 5453
51 Ga0466718_015171 3300042617 Bacteria 10886
52 AustNasuHG_c1056613 3300000089 Bacteria 788
53 JGI24698J34947_10080743 3300002449 Bacteria 1527
54 JGI24695J34938_10001647 3300002450 Bacteria 18582
55 JGI24695J34938_10003153 3300002450 Bacteria 11730
56 Ga0466700_177342 3300042600 Bacteria 1149
57 Ga0466700_191856 3300042600 Bacteria 1217
58 Ga0466720_086674 3300042607 Bacteria 26644
59 Ga0123356_10000152 3300010049 Bacteria 78065
60 Ga0466694_169170 3300042594 Bacteria 5410
61 Ga0466712_003796 3300042614 Bacteria 14120
62 Ga0466712_026119 3300042614 Bacteria 16171
63 Ga0466718_002493 3300042617 Bacteria 2781
64 Ga0466718_108522 3300042617 Bacteria 34323
65 Ga0466731_121673 3300042622 Bacteria 1736
66 Ga0466731_128667 3300042622 Bacteria 14380
67 Ga0466702_092930 3300042635 Unclassified 1824
68 AustNasuHG_c1002024 3300000089 Bacteria 7301
69 AustNasuHG_c1020983 3300000089 Unclassified 2120
70 AustNasuHG_c1067242 3300000089 Bacteria 662
71 JGI24698J34947_10000406 3300002449 Bacteria 19632
72 JGI24695J34938_10000350 3300002450 Bacteria 45521
73 JGI24695J34938_10001001 3300002450 Bacteria 25675
74 JGI24695J34938_10004544 3300002450 Bacteria 9046
75 JGI24695J34938_10005415 3300002450 Bacteria 7967
76 JGI24699J35502_11116415 3300002509 Unclassified 2968
77 Ga0072941_1012019 3300005201 Unclassified 16271
78 Ga0466717_264689 3300042604 Bacteria 1095
79 Ga0466720_074939 3300042607 Bacteria 10381
80 Ga0466720_113267 3300042607 Bacteria 2325
81 Ga0466721_354360 3300042608 Bacteria 1541
82 Ga0123356_10071285 3300010049 Bacteria 3262
83 Ga0415639_003056 3300038395 Bacteria 16768
84 Ga0415639_008020 3300038395 Bacteria 3145
85 Ga0466694_009362 3300042594 Bacteria 28493
86 Ga0466699_040083 3300042597 Bacteria 5933
87 Ga0466699_168042 3300042597 Bacteria 1964
88 Ga0466712_029701 3300042614 Bacteria 1403
89 Ga0466712_145862 3300042614 Unclassified 4046
90 JGI24698J34947_10034564 3300002449 Bacteria 2644
91 JGI24695J34938_10007596 3300002450 Bacteria 6313
92 JGI24695J34938_10010536 3300002450 Bacteria 5049
93 JGI24695J34938_10243825 3300002450 Bacteria 760
94 Ga0072941_1015462 3300005201 Bacteria 14518
95 Ga0466698_383635 3300042610 Bacteria 14424
96 Ga0123356_10711013 3300010049 Bacteria 1174
97 Ga0123356_10809043 3300010049 Bacteria 1108
98 Ga0123356_13274612 3300010049 Unclassified 563
99 Ga0123353_10086950 3300010167 Bacteria 5036
100 Ga0123353_11792546 3300010167 Bacteria 763
101 Ga0223679_111306 3300021218 Bacteria 509
102 Ga0415639_000341 3300038395 Bacteria 8443
103 Ga0466699_150152 3300042597 Bacteria 4528
104 Ga0466712_023398 3300042614 Bacteria 5375
105 Ga0466731_041738 3300042622 Bacteria 1027
106 Ga0466730_027235 3300042625 Bacteria 1504
107 AustNasuHG_c1015084 3300000089 Bacteria 2614
108 FAAS_10400834 3300001880 Unclassified 541
109 JGI24698J34947_10039170 3300002449 Unclassified 2455
110 JGI24695J34938_10020047 3300002450 Bacteria 3299
111 Ga0072940_1049966 3300005200 Unclassified 1382
112 Ga0466732_024721 3300042656 Bacteria 22695
113 Ga0466720_040089 3300042607 Unclassified 1910
114 Ga0466720_150961 3300042607 Bacteria 3786
115 Ga0123355_10121769 3300009826 Bacteria 4044
116 Ga0123356_10002756 3300010049 Bacteria 18666
117 Ga0123356_10003666 3300010049 Bacteria 16004
118 Ga0123356_10019383 3300010049 Bacteria 6448
119 Ga0123353_10504357 3300010167 Bacteria 1762
120 Ga0123353_12607005 3300010167 Bacteria 598
121 Ga0123353_12697618 3300010167 Bacteria 585
122 Ga0123353_12821768 3300010167 Bacteria 568
123 Ga0466693_085049 3300042592 Bacteria 1813
124 Ga0466694_061950 3300042594 Bacteria 20356
125 Ga0466699_281342 3300042597 Bacteria 10527
126 Ga0466718_019967 3300042617 Bacteria 11650
127 Ga0466731_389079 3300042622 Bacteria 6620
128 Ga0466731_415872 3300042622 Bacteria 1752
129 AustNasuHG_c1001161 3300000089 Unclassified 9437
130 JGI24698J34947_10001212 3300002449 Bacteria 13496
131 JGI24698J34947_10049286 3300002449 Bacteria 2129
132 JGI24695J34938_10000778 3300002450 Bacteria 29892
133 JGI24697J35500_11266197 3300002507 Bacteria 3493
134 Ga0123356_10000283 3300010049 Bacteria 58609
135 Ga0123356_10038078 3300010049 Bacteria 4483
136 Ga0123356_10168933 3300010049 Bacteria 2195
137 Ga0415639_020608 3300038395 Bacteria 1317
138 Ga0466712_205092 3300042614 Bacteria 20979
139 Ga0466712_235872 3300042614 Bacteria 8616
140 Ga0466731_226195 3300042622 Bacteria 1087
141 Ga0466702_050633 3300042635 Bacteria 3144
142 Ga0466702_060519 3300042635 Bacteria 1634
143 AustNasuHG_c1026335 3300000089 Unclassified 1812
144 JGI24698J34947_10005103 3300002449 Bacteria 7195
145 JGI24698J34947_10016490 3300002449 Bacteria 4010
146 JGI24698J34947_10026887 3300002449 Unclassified 3055
147 JGI24698J34947_10056013 3300002449 Unclassified 1962
148 JGI24698J34947_10090355 3300002449 Bacteria 1407
149 JGI24695J34938_10000551 3300002450 Bacteria 36191
150 JGI24695J34938_10001017 3300002450 Bacteria 25353
151 JGI24695J34938_10002611 3300002450 Bacteria 13550
152 JGI24695J34938_10003574 3300002450 Bacteria 10711
153 JGI24695J34938_10011871 3300002450 Bacteria 4658
154 Ga0072941_1012466 3300005201 Bacteria 11515
155 Ga0072941_1017427 3300005201 Bacteria 23253

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_264689 Ga0466717_264689_528_950 140
2 3300021218 Ga0223679_111306 Ga0223679_1113061 142
3 3300038395 Ga0415639_003056 Ga0415639_003056_8892_9320 142
4 3300038395 Ga0415639_008020 Ga0415639_008020_2251_2679 142
5 3300038395 Ga0415639_020608 Ga0415639_020608_357_785 142
6 3300042550 Ga0466656_383391 Ga0466656_383391_572_1000 142
7 3300042592 Ga0466693_085049 Ga0466693_085049_532_960 142
8 3300042594 Ga0466694_009362 Ga0466694_009362_1950_2378 142
9 3300042594 Ga0466694_042247 Ga0466694_042247_8131_8559 142
10 3300042594 Ga0466694_061950 Ga0466694_061950_16179_16607 142
11 3300042594 Ga0466694_169170 Ga0466694_169170_623_1051 142
12 3300042597 Ga0466699_006172 Ga0466699_006172_93_521 142
13 3300042597 Ga0466699_150152 Ga0466699_150152_2965_3393 142
14 3300042597 Ga0466699_168042 Ga0466699_168042_1265_1693 142
15 3300042597 Ga0466699_191763 Ga0466699_191763_127_555 142
16 3300042597 Ga0466699_281342 Ga0466699_281342_4960_5388 142
17 3300042597 Ga0466699_439515 Ga0466699_439515_85_513 142
18 3300042600 Ga0466700_191856 Ga0466700_191856_454_882 142
19 3300042607 Ga0466720_003412 Ga0466720_003412_605_1033 142
20 3300042607 Ga0466720_014626 Ga0466720_014626_34842_35270 142
21 3300042607 Ga0466720_040089 Ga0466720_040089_1362_1790 142
22 3300042607 Ga0466720_068836 Ga0466720_068836_8598_9026 142
23 3300042607 Ga0466720_074939 Ga0466720_074939_4036_4464 142
24 3300042607 Ga0466720_086674 Ga0466720_086674_413_841 142
25 3300042607 Ga0466720_150961 Ga0466720_150961_72_500 142
26 3300042607 Ga0466720_152084 Ga0466720_152084_5881_6309 142
27 3300042608 Ga0466721_080676 Ga0466721_080676_32597_33025 142
28 3300042608 Ga0466721_293255 Ga0466721_293255_491_919 142
29 3300042608 Ga0466721_354360 Ga0466721_354360_933_1361 142
30 3300042609 Ga0466722_077441 Ga0466722_077441_1997_2425 142
31 3300042609 Ga0466722_222135 Ga0466722_222135_1810_2238 142
32 3300042610 Ga0466698_219696 Ga0466698_219696_333_761 142
33 3300042610 Ga0466698_383635 Ga0466698_383635_2481_2909 142
34 3300042614 Ga0466712_001453 Ga0466712_001453_3734_4162 142
35 3300042614 Ga0466712_003796 Ga0466712_003796_3034_3462 142
36 3300042614 Ga0466712_023398 Ga0466712_023398_759_1187 142
37 3300042614 Ga0466712_026119 Ga0466712_026119_8139_8567 142
38 3300042614 Ga0466712_030929 Ga0466712_030929_2951_3379 142
39 3300042614 Ga0466712_145862 Ga0466712_145862_966_1394 142
40 3300042614 Ga0466712_146184 Ga0466712_146184_139_567 142
41 3300042614 Ga0466712_205092 Ga0466712_205092_11366_11794 142
42 3300042614 Ga0466712_235872 Ga0466712_235872_6811_7239 142
43 3300042614 Ga0466712_277071 Ga0466712_277071_13912_14340 142
44 3300042614 Ga0466712_321597 Ga0466712_321597_3734_4162 142
45 3300042617 Ga0466718_002493 Ga0466718_002493_2321_2749 142
46 3300042617 Ga0466718_009636 Ga0466718_009636_3923_4351 142
47 3300042617 Ga0466718_015171 Ga0466718_015171_1981_2409 142
48 3300042617 Ga0466718_019967 Ga0466718_019967_3766_4194 142
49 3300042617 Ga0466718_096010 Ga0466718_096010_3077_3505 142
50 3300042622 Ga0466731_041738 Ga0466731_041738_263_691 142
51 3300042622 Ga0466731_121673 Ga0466731_121673_830_1258 142
52 3300042622 Ga0466731_128667 Ga0466731_128667_11782_12210 142
53 3300042622 Ga0466731_226195 Ga0466731_226195_271_699 142
54 3300042622 Ga0466731_389079 Ga0466731_389079_1883_2311 142
55 3300042622 Ga0466731_412863 Ga0466731_412863_600_1028 142
56 3300042622 Ga0466731_415872 Ga0466731_415872_682_1110 142
57 3300042625 Ga0466730_027235 Ga0466730_027235_623_1051 142
58 3300042635 Ga0466702_044195 Ga0466702_044195_6870_7298 142
59 3300042635 Ga0466702_060519 Ga0466702_060519_727_1155 142
60 3300042635 Ga0466702_092930 Ga0466702_092930_91_519 142
61 3300042635 Ga0466702_120851 Ga0466702_120851_447_875 142
62 3300042635 Ga0466702_315454 Ga0466702_315454_2093_2521 142
63 3300042635 Ga0466702_375699 Ga0466702_375699_996_1424 142
64 3300042656 Ga0466732_024721 Ga0466732_024721_19606_20034 142
65 3300042656 Ga0466732_102796 Ga0466732_102796_412_840 142
66 3300042656 Ga0466732_130011 Ga0466732_130011_425_853 142
67 iso_pr_bacteria 2781125634 2781276228 142
68 iso_pr_bacteria 2781125635 2781278225 142
69 iso_pr_bacteria 2781125637 2781281507 142
70 iso_pr_bacteria 2781125638 2781284019 142
71 iso_pr_bacteria 2781125642 2781292257 142
72 iso_pr_bacteria 2781125645 2781299655 142
73 iso_pr_bacteria 2781125656 2781321783 142
74 iso_pr_bacteria 2781125659 2781327559 142
75 iso_pr_bacteria 2781125660 2781330995 142
76 iso_pr_bacteria 2781125661 2781332568 142
77 iso_pr_bacteria 2781125663 2781337674 142
78 iso_pr_bacteria 2781125664 2781340901 142
79 iso_pr_bacteria 2781125689 2781425045 142
80 iso_pr_bacteria 2781125692 2781432083 142
81 iso_pr_bacteria 2781125693 2781434037 142
82 iso_pr_bacteria 2819992462 2819993280 142
83 iso_pr_bacteria 2819994798 2819998041 142
84 iso_pr_bacteria 2820020240 2820020966 142
85 3300000089 AustNasuHG_c1001161 AustNasuHG_10011616 143
86 3300000089 AustNasuHG_c1001696 AustNasuHG_10016964 143
87 3300000089 AustNasuHG_c1002024 AustNasuHG_100202410 143
88 3300000089 AustNasuHG_c1015084 AustNasuHG_10150842 143
89 3300000089 AustNasuHG_c1020983 AustNasuHG_10209834 143
90 3300000089 AustNasuHG_c1026335 AustNasuHG_10263355 143
91 3300000089 AustNasuHG_c1042995 AustNasuHG_10429952 143
92 3300000089 AustNasuHG_c1056613 AustNasuHG_10566132 143
93 3300000089 AustNasuHG_c1067242 AustNasuHG_10672421 143
94 3300001880 FAAS_10006615 FAAS_100066151 143
95 3300001880 FAAS_10006681 FAAS_100066812 143
96 3300001880 FAAS_10400834 FAAS_104008341 143
97 3300002449 JGI24698J34947_10000406 JGI24698J34947_1000040615 143
98 3300002449 JGI24698J34947_10001212 JGI24698J34947_100012127 143
99 3300002449 JGI24698J34947_10005103 JGI24698J34947_100051038 143
100 3300002449 JGI24698J34947_10016490 JGI24698J34947_100164904 143
101 3300002449 JGI24698J34947_10026887 JGI24698J34947_100268876 143
102 3300002449 JGI24698J34947_10034564 JGI24698J34947_100345644 143
103 3300002449 JGI24698J34947_10039170 JGI24698J34947_100391702 143
104 3300002449 JGI24698J34947_10056013 JGI24698J34947_100560132 143
105 3300002449 JGI24698J34947_10080743 JGI24698J34947_100807432 143
106 3300002449 JGI24698J34947_10090355 JGI24698J34947_100903552 143
107 3300002450 JGI24695J34938_10000350 JGI24695J34938_1000035044 143
108 3300002450 JGI24695J34938_10000551 JGI24695J34938_1000055133 143
109 3300002450 JGI24695J34938_10000778 JGI24695J34938_1000077825 143
110 3300002450 JGI24695J34938_10001001 JGI24695J34938_1000100125 143
111 3300002450 JGI24695J34938_10001017 JGI24695J34938_100010171 143
112 3300002450 JGI24695J34938_10001647 JGI24695J34938_100016477 143
113 3300002450 JGI24695J34938_10002611 JGI24695J34938_100026119 143
114 3300002450 JGI24695J34938_10003153 JGI24695J34938_1000315318 143
115 3300002450 JGI24695J34938_10003574 JGI24695J34938_100035745 143
116 3300002450 JGI24695J34938_10004544 JGI24695J34938_100045445 143
117 3300002450 JGI24695J34938_10005415 JGI24695J34938_100054157 143
118 3300002450 JGI24695J34938_10007596 JGI24695J34938_100075962 143
119 3300002450 JGI24695J34938_10010283 JGI24695J34938_100102837 143
120 3300002450 JGI24695J34938_10010536 JGI24695J34938_100105363 143
121 3300002450 JGI24695J34938_10011579 JGI24695J34938_100115793 143
122 3300002450 JGI24695J34938_10011871 JGI24695J34938_100118715 143
123 3300002450 JGI24695J34938_10019172 JGI24695J34938_100191723 143
124 3300002450 JGI24695J34938_10020047 JGI24695J34938_100200478 143
125 3300002450 JGI24695J34938_10031240 JGI24695J34938_100312402 143
126 3300002450 JGI24695J34938_10065738 JGI24695J34938_100657382 143
127 3300002450 JGI24695J34938_10069158 JGI24695J34938_100691582 143
128 3300002450 JGI24695J34938_10243825 JGI24695J34938_102438251 143
129 3300002450 JGI24695J34938_10248560 JGI24695J34938_102485601 143
130 3300002507 JGI24697J35500_11266197 JGI24697J35500_112661973 143
131 3300002509 JGI24699J35502_11116415 JGI24699J35502_111164152 143
132 3300005200 Ga0072940_1049966 Ga0072940_10499661 143
133 3300005201 Ga0072941_1012019 Ga0072941_101201911 143
134 3300005201 Ga0072941_1012466 Ga0072941_101246612 143
135 3300005201 Ga0072941_1015462 Ga0072941_101546210 143
136 3300005201 Ga0072941_1017427 Ga0072941_101742711 143
137 3300010049 Ga0123356_10000152 Ga0123356_1000015211 143
138 3300010049 Ga0123356_10000283 Ga0123356_100002832 143
139 3300010049 Ga0123356_10001758 Ga0123356_1000175816 143
140 3300010049 Ga0123356_10002756 Ga0123356_1000275617 143
141 3300010049 Ga0123356_10003666 Ga0123356_100036667 143
142 3300010049 Ga0123356_10004155 Ga0123356_100041558 143
143 3300010049 Ga0123356_10019383 Ga0123356_100193836 143
144 3300010049 Ga0123356_10038078 Ga0123356_100380785 143
145 3300010049 Ga0123356_10105104 Ga0123356_101051043 143
146 3300010049 Ga0123356_10189988 Ga0123356_101899884 143
147 3300010049 Ga0123356_10541768 Ga0123356_105417681 143
148 3300010049 Ga0123356_10711013 Ga0123356_107110133 143
149 3300010049 Ga0123356_10809043 Ga0123356_108090431 143
150 3300010049 Ga0123356_12707820 Ga0123356_127078201 143
151 3300010049 Ga0123356_13274612 Ga0123356_132746121 143
152 3300010167 Ga0123353_10394946 Ga0123353_103949462 143
153 3300010167 Ga0123353_10504357 Ga0123353_105043572 143
154 3300010167 Ga0123353_10798431 Ga0123353_107984311 143
155 3300010167 Ga0123353_11792546 Ga0123353_117925462 143
156 3300010167 Ga0123353_12607005 Ga0123353_126070051 143
157 3300010167 Ga0123353_12697618 Ga0123353_126976181 143
158 3300010167 Ga0123353_12821768 Ga0123353_128217681 143
159 3300042635 Ga0466702_050633 Ga0466702_050633_1680_2111 143
160 3300002449 JGI24698J34947_10049286 JGI24698J34947_100492862 144
161 3300042600 Ga0466700_177342 Ga0466700_177342_424_858 144
162 3300042622 Ga0466731_353475 Ga0466731_353475_832_1266 144
163 3300038395 Ga0415639_000341 Ga0415639_000341_6275_6715 146
164 3300010167 Ga0123353_10086950 Ga0123353_100869507 147
165 3300009826 Ga0123355_10121769 Ga0123355_101217694 150
166 3300010049 Ga0123356_10168933 Ga0123356_101689333 150
167 3300042607 Ga0466720_109571 Ga0466720_109571_10884_11348 154
168 3300042614 Ga0466712_029701 Ga0466712_029701_657_1121 154
169 3300042617 Ga0466718_108522 Ga0466718_108522_1153_1617 154
170 3300010049 Ga0123356_11696822 Ga0123356_116968222 155
171 3300010049 Ga0123356_10071285 Ga0123356_100712852 157
172 3300042597 Ga0466699_040083 Ga0466699_040083_3493_3966 157
173 iso_pr_bacteria 2740892545 2743907000 159
174 3300042607 Ga0466720_113267 Ga0466720_113267_1232_1750 172

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00572 Ribosomal_L13 Ribosomal protein L13 43 161 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.66 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.