Protein Family IF06642

Metagenome Metatranscriptome Isolate
125 Members
39 Samples
123 Scaffolds
174.1 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_085547|Ga0466720_085547_464_1066
Length
200 aa
Sequence
MYFDRIFFIFLFCIFYDNFVFKERKVNEAVMYAKYNQAANKAILDLLKKLNNDDRERDRGSFYGSLSGLFRHVLGSIRFFLGMYKTALGGNAAALKAISAIETLPEFPEGSLNETQWNELQSAATVIDTAYIAMAQALNASDLSLPVKTAWYGGNPASVPLSFMLSQLVVHNTHHRGQISQILDSMVIANDYSGIDVSFL

📊 Sample Types

Isolate 1.6%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.5%
Kalotermitidae 35.1%
Unclassified 8.1%
Rhinotermitidae 8.1%
Termopsidae 8.1%

🌳 Taxonomy

Archaea 2
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
13 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
14 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
20 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
24 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
33 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
34 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_102075 3300042612 Bacteria 1014
2 Ga0072940_1105237 3300005200 Bacteria 1141
3 Ga0466719_133151 3300042606 Bacteria 1170
4 Ga0466720_085547 3300042607 Bacteria 4033
5 Ga0466720_228515 3300042607 Bacteria 2364
6 Ga0466704_310515 3300042643 Bacteria 1096
7 Ga0466704_425636 3300042643 Bacteria 27682
8 Ga0466708_040166 3300042652 Bacteria 2589
9 Ga0466692_056617 3300042591 Bacteria 76518
10 Ga0466694_199098 3300042594 Bacteria 7152
11 Ga0466696_153535 3300042596 Bacteria 5922
12 Ga0466711_082019 3300042615 Bacteria 7020
13 Ga0466715_271746 3300042616 Bacteria 8350
14 Ga0466715_519613 3300042616 Bacteria 6989
15 Ga0466718_002239 3300042617 Bacteria 4843
16 Ga0466718_138997 3300042617 Unclassified 11910
17 Ga0466732_027843 3300042656 Bacteria 3228
18 Ga0466732_281350 3300042656 Bacteria 4788
19 AustNasuHG_c1058321 3300000089 Bacteria 764
20 Ga0466716_330047 3300042605 Bacteria 3191
21 Ga0466722_096401 3300042609 Bacteria 1629
22 Ga0466702_024429 3300042635 Bacteria 1797
23 Ga0466708_166110 3300042652 Bacteria 5103
24 Ga0264413_117629 3300024493 Bacteria 4366
25 Ga0466692_125052 3300042591 Bacteria 28079
26 Ga0466691_092417 3300042593 Bacteria 1500
27 Ga0466694_171898 3300042594 Bacteria 1659
28 Ga0466699_174872 3300042597 Bacteria 3442
29 Ga0466699_256373 3300042597 Bacteria 1422
30 Ga0466705_442698 3300042612 Bacteria 3449
31 Ga0466718_006478 3300042617 Bacteria 44889
32 JGI24698J34947_10041083 3300002449 Bacteria 2384
33 Ga0072940_1043415 3300005200 Bacteria 4460
34 Ga0466720_079984 3300042607 Bacteria 7179
35 Ga0264413_131425 3300024493 Bacteria 6022
36 Ga0466694_303431 3300042594 Bacteria 1644
37 Ga0466699_206699 3300042597 Unclassified 2222
38 Ga0466723_030584 3300042618 Bacteria 6922
39 Ga0466723_071736 3300042618 Bacteria 57252
40 Ga0466726_075911 3300042619 Bacteria 2212
41 Ga0466717_084155 3300042604 Bacteria 1029
42 Ga0466719_130367 3300042606 Bacteria 2602
43 Ga0466719_442331 3300042606 Bacteria 4186
44 Ga0466720_001295 3300042607 Bacteria 32202
45 Ga0466720_117535 3300042607 Bacteria 20172
46 Ga0466702_111493 3300042635 Bacteria 3447
47 Ga0466704_286001 3300042643 Bacteria 16185
48 Ga0466708_365586 3300042652 Bacteria 2184
49 Ga0223677_1013471 3300021239 Archaea 2154
50 Ga0264413_122255 3300024493 Bacteria 2200
51 Ga0466690_195850 3300042590 Bacteria 1584
52 Ga0466691_202850 3300042593 Bacteria 3547
53 Ga0466699_007342 3300042597 Bacteria 1609
54 Ga0466699_060884 3300042597 Bacteria 2022
55 Ga0466699_189630 3300042597 Bacteria 1622
56 Ga0123354_10187077 3300010882 Bacteria 2337
57 Ga0466711_387402 3300042615 Bacteria 1458
58 Ga0466715_046174 3300042616 Bacteria 30258
59 Ga0466718_023512 3300042617 Bacteria 6605
60 Ga0466718_080987 3300042617 Bacteria 2437
61 Ga0466718_135867 3300042617 Bacteria 1082
62 Ga0466705_193608 3300042612 Bacteria 1763
63 Ga0466732_215404 3300042656 Bacteria 1481
64 AustNasuHG_c1002711 3300000089 Bacteria 6387
65 JGI24695J34938_10031539 3300002450 Archaea 2458
66 Ga0466720_077951 3300042607 Unclassified 2658
67 Ga0466698_215742 3300042610 Bacteria 1088
68 Ga0466735_171727 3300042624 Bacteria 1101
69 Ga0466704_207177 3300042643 Bacteria 2552
70 Ga0456237_0004559 3300041968 Bacteria 2223
71 Ga0466711_176325 3300042615 Bacteria 3878
72 Ga0466715_060672 3300042616 Bacteria 14896
73 Ga0466718_002642 3300042617 Bacteria 4009
74 Ga0466705_194079 3300042612 Bacteria 1558
75 Ga0466732_000487 3300042656 Bacteria 17316
76 Ga0466707_012168 3300042601 Bacteria 1395
77 Ga0466702_324209 3300042635 Bacteria 11014
78 Ga0466703_185732 3300042636 Bacteria 1096
79 Ga0466704_104942 3300042643 Bacteria 1151
80 Ga0466709_163067 3300042648 Bacteria 7259
81 Ga0466694_068600 3300042594 Bacteria 1505
82 Ga0466699_323934 3300042597 Bacteria 2862
83 Ga0466699_412648 3300042597 Bacteria 3016
84 Ga0466705_520939 3300042612 Unclassified 1263
85 Ga0466718_030347 3300042617 Bacteria 17552
86 Ga0466718_042441 3300042617 Bacteria 8555
87 Ga0466726_356363 3300042619 Bacteria 3232
88 Ga0466705_207963 3300042612 Bacteria 6658
89 Ga0466732_455907 3300042656 Bacteria 4250
90 Ga0072940_1065839 3300005200 Bacteria 3269
91 Ga0466720_074797 3300042607 Bacteria 8674
92 Ga0466720_092813 3300042607 Bacteria 7868
93 Ga0466722_203595 3300042609 Bacteria 2354
94 Ga0466702_326647 3300042635 Bacteria 4945
95 Ga0466702_388867 3300042635 Bacteria 1976
96 Ga0466727_208083 3300042655 Bacteria 1272
97 Ga0466694_167907 3300042594 Bacteria 4786
98 Ga0466699_080409 3300042597 Bacteria 2249
99 Ga0466699_251342 3300042597 Bacteria 1037
100 Ga0466715_105055 3300042616 Bacteria 2402
101 Ga0466718_170154 3300042617 Bacteria 4482
102 Ga0466723_059040 3300042618 Bacteria 3871
103 Ga0466726_176552 3300042619 Bacteria 1056
104 Ga0466705_126746 3300042612 Bacteria 23522
105 Ga0466705_222720 3300042612 Bacteria 18831
106 Ga0466732_015118 3300042656 Bacteria 10235
107 Ga0466732_021219 3300042656 Bacteria 2759
108 Ga0466732_355253 3300042656 Bacteria 5780
109 Ga0466733_192556 3300042659 Bacteria 11796
110 AustNasuHG_c1023796 3300000089 Bacteria 1950
111 JGI24702J35022_10392649 3300002462 Bacteria 836
112 Ga0466720_017690 3300042607 Bacteria 1010
113 Ga0466698_317103 3300042610 Bacteria 1462
114 Ga0466704_195868 3300042643 Bacteria 6648
115 Ga0466704_397736 3300042643 Unclassified 1339
116 Ga0264413_114711 3300024493 Bacteria 3694
117 Ga0456237_0002856 3300041968 Bacteria 2802
118 Ga0466692_042170 3300042591 Bacteria 4545
119 Ga0466699_192770 3300042597 Bacteria 2346
120 Ga0466699_230918 3300042597 Bacteria 2404
121 Ga0466715_145171 3300042616 Bacteria 8955
122 Ga0466718_092716 3300042617 Bacteria 1691
123 Ga0466726_294306 3300042619 Bacteria 1058

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_251342 Ga0466699_251342_562_1023 153
2 3300042612 Ga0466705_520939 Ga0466705_520939_192_725 159
3 3300042643 Ga0466704_195868 Ga0466704_195868_2919_3452 159
4 3300042617 Ga0466718_138997 Ga0466718_138997_9568_10095 160
5 3300042612 Ga0466705_193608 Ga0466705_193608_518_1051 161
6 3300042643 Ga0466704_397736 Ga0466704_397736_150_683 161
7 3300024493 Ga0264413_114711 Ga0264413_1147113 162
8 3300042612 Ga0466705_194079 Ga0466705_194079_560_1093 162
9 3300042612 Ga0466705_442698 Ga0466705_442698_2734_3267 162
10 3300042610 Ga0466698_317103 Ga0466698_317103_785_1318 163
11 3300042643 Ga0466704_207177 Ga0466704_207177_1883_2416 164
12 3300042643 Ga0466704_310515 Ga0466704_310515_437_970 164
13 3300042607 Ga0466720_079984 Ga0466720_079984_1835_2368 165
14 3300042635 Ga0466702_111493 Ga0466702_111493_667_1194 165
15 3300042615 Ga0466711_082019 Ga0466711_082019_127_660 168
16 3300042594 Ga0466694_303431 Ga0466694_303431_267_776 169
17 3300042615 Ga0466711_387402 Ga0466711_387402_408_917 169
18 3300042607 Ga0466720_001295 Ga0466720_001295_19545_20057 170
19 3300042617 Ga0466718_023512 Ga0466718_023512_444_956 170
20 3300042607 Ga0466720_074797 Ga0466720_074797_2319_2834 171
21 3300041968 Ga0456237_0002856 Ga0456237_0002856_1383_1901 172
22 3300042591 Ga0466692_042170 Ga0466692_042170_2693_3211 172
23 3300042606 Ga0466719_133151 Ga0466719_133151_54_572 172
24 3300042607 Ga0466720_228515 Ga0466720_228515_336_854 172
25 3300042612 Ga0466705_207963 Ga0466705_207963_5836_6354 172
26 3300042616 Ga0466715_271746 Ga0466715_271746_4479_4997 172
27 3300042643 Ga0466704_104942 Ga0466704_104942_51_569 172
28 3300042656 Ga0466732_281350 Ga0466732_281350_1335_1868 172
29 iso_pr_bacteria 2781125683 2781411452 172
30 3300002462 JGI24702J35022_10392649 JGI24702J35022_103926491 173
31 3300042593 Ga0466691_092417 Ga0466691_092417_311_832 173
32 3300042596 Ga0466696_153535 Ga0466696_153535_3895_4416 173
33 3300042618 Ga0466723_059040 Ga0466723_059040_2776_3297 173
34 3300042652 Ga0466708_040166 Ga0466708_040166_1269_1790 173
35 3300002450 JGI24695J34938_10031539 JGI24695J34938_100315392 174
36 3300042590 Ga0466690_195850 Ga0466690_195850_106_630 174
37 3300042594 Ga0466694_068600 Ga0466694_068600_23_547 174
38 3300042605 Ga0466716_330047 Ga0466716_330047_1649_2173 174
39 3300042606 Ga0466719_130367 Ga0466719_130367_1451_1975 174
40 3300042606 Ga0466719_442331 Ga0466719_442331_240_764 174
41 3300042612 Ga0466705_126746 Ga0466705_126746_3550_4074 174
42 3300042616 Ga0466715_046174 Ga0466715_046174_986_1510 174
43 3300042616 Ga0466715_060672 Ga0466715_060672_12485_13009 174
44 3300042616 Ga0466715_105055 Ga0466715_105055_1783_2307 174
45 3300042618 Ga0466723_071736 Ga0466723_071736_53299_53823 174
46 3300042643 Ga0466704_425636 Ga0466704_425636_4481_5005 174
47 3300042648 Ga0466709_163067 Ga0466709_163067_2940_3464 174
48 3300042652 Ga0466708_166110 Ga0466708_166110_2355_2879 174
49 3300000089 AustNasuHG_c1058321 AustNasuHG_10583211 175
50 3300024493 Ga0264413_117629 Ga0264413_1176291 175
51 3300024493 Ga0264413_122255 Ga0264413_1222553 175
52 3300024493 Ga0264413_131425 Ga0264413_1314257 175
53 3300042591 Ga0466692_125052 Ga0466692_125052_18054_18581 175
54 3300042593 Ga0466691_202850 Ga0466691_202850_306_833 175
55 3300042594 Ga0466694_199098 Ga0466694_199098_2543_3070 175
56 3300042597 Ga0466699_007342 Ga0466699_007342_329_856 175
57 3300042597 Ga0466699_174872 Ga0466699_174872_112_639 175
58 3300042597 Ga0466699_323934 Ga0466699_323934_1466_1993 175
59 3300042597 Ga0466699_412648 Ga0466699_412648_2324_2851 175
60 3300042607 Ga0466720_077951 Ga0466720_077951_1102_1629 175
61 3300042617 Ga0466718_002239 Ga0466718_002239_2632_3159 175
62 3300042617 Ga0466718_030347 Ga0466718_030347_11750_12277 175
63 3300042617 Ga0466718_092716 Ga0466718_092716_1046_1573 175
64 3300042618 Ga0466723_030584 Ga0466723_030584_5610_6137 175
65 3300042635 Ga0466702_024429 Ga0466702_024429_372_899 175
66 3300042635 Ga0466702_388867 Ga0466702_388867_14_541 175
67 3300042655 Ga0466727_208083 Ga0466727_208083_360_887 175
68 3300042656 Ga0466732_000487 Ga0466732_000487_15929_16456 175
69 3300042656 Ga0466732_021219 Ga0466732_021219_737_1264 175
70 3300042656 Ga0466732_027843 Ga0466732_027843_737_1264 175
71 3300042656 Ga0466732_215404 Ga0466732_215404_315_842 175
72 3300042656 Ga0466732_455907 Ga0466732_455907_1097_1624 175
73 3300000089 AustNasuHG_c1023796 AustNasuHG_10237961 176
74 3300002449 JGI24698J34947_10041083 JGI24698J34947_100410832 176
75 3300005200 Ga0072940_1065839 Ga0072940_10658393 176
76 3300005200 Ga0072940_1105237 Ga0072940_11052371 176
77 3300042591 Ga0466692_056617 Ga0466692_056617_27227_27757 176
78 3300042594 Ga0466694_171898 Ga0466694_171898_433_963 176
79 3300042597 Ga0466699_060884 Ga0466699_060884_74_604 176
80 3300042597 Ga0466699_080409 Ga0466699_080409_1010_1540 176
81 3300042597 Ga0466699_189630 Ga0466699_189630_157_687 176
82 3300042597 Ga0466699_192770 Ga0466699_192770_821_1351 176
83 3300042597 Ga0466699_230918 Ga0466699_230918_160_690 176
84 3300042597 Ga0466699_256373 Ga0466699_256373_702_1232 176
85 3300042604 Ga0466717_084155 Ga0466717_084155_347_877 176
86 3300042617 Ga0466718_080987 Ga0466718_080987_1485_2015 176
87 3300042635 Ga0466702_326647 Ga0466702_326647_450_980 176
88 3300042643 Ga0466704_286001 Ga0466704_286001_9762_10292 176
89 iso_pr_bacteria 2781125631 2781268891 176
90 3300000089 AustNasuHG_c1002711 AustNasuHG_10027114 177
91 3300021239 Ga0223677_1013471 Ga0223677_10134711 177
92 3300041968 Ga0456237_0004559 Ga0456237_0004559_365_898 177
93 3300042597 Ga0466699_206699 Ga0466699_206699_1635_2168 177
94 3300042607 Ga0466720_017690 Ga0466720_017690_48_581 177
95 3300042607 Ga0466720_117535 Ga0466720_117535_9540_10073 177
96 3300042612 Ga0466705_102075 Ga0466705_102075_376_909 177
97 3300042612 Ga0466705_222720 Ga0466705_222720_15030_15563 177
98 3300042615 Ga0466711_176325 Ga0466711_176325_2591_3124 177
99 3300042616 Ga0466715_519613 Ga0466715_519613_3257_3790 177
100 3300042617 Ga0466718_002642 Ga0466718_002642_1763_2296 177
101 3300042617 Ga0466718_042441 Ga0466718_042441_3856_4389 177
102 3300042619 Ga0466726_075911 Ga0466726_075911_53_586 177
103 3300042619 Ga0466726_176552 Ga0466726_176552_376_909 177
104 3300042619 Ga0466726_294306 Ga0466726_294306_202_735 177
105 3300042636 Ga0466703_185732 Ga0466703_185732_329_862 177
106 3300042656 Ga0466732_355253 Ga0466732_355253_2809_3342 177
107 3300042659 Ga0466733_192556 Ga0466733_192556_8539_9072 177
108 3300005200 Ga0072940_1043415 Ga0072940_10434155 178
109 3300042594 Ga0466694_167907 Ga0466694_167907_3355_3891 178
110 3300042601 Ga0466707_012168 Ga0466707_012168_615_1151 178
111 3300042609 Ga0466722_096401 Ga0466722_096401_1001_1537 178
112 3300042635 Ga0466702_324209 Ga0466702_324209_8579_9115 178
113 3300042652 Ga0466708_365586 Ga0466708_365586_110_646 178
114 3300042616 Ga0466715_145171 Ga0466715_145171_417_956 179
115 3300042617 Ga0466718_170154 Ga0466718_170154_251_790 179
116 3300042624 Ga0466735_171727 Ga0466735_171727_25_564 179
117 3300042656 Ga0466732_015118 Ga0466732_015118_3850_4389 179
118 3300010882 Ga0123354_10187077 Ga0123354_101870773 180
119 3300042609 Ga0466722_203595 Ga0466722_203595_152_694 180
120 3300042617 Ga0466718_006478 Ga0466718_006478_20513_21055 180
121 3300042619 Ga0466726_356363 Ga0466726_356363_2653_3198 181
122 3300042617 Ga0466718_135867 Ga0466718_135867_451_999 182
123 3300042607 Ga0466720_092813 Ga0466720_092813_5893_6450 185
124 3300042610 Ga0466698_215742 Ga0466698_215742_422_985 187
125 3300042607 Ga0466720_085547 Ga0466720_085547_464_1066 200

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05163 DinB DinB family 31 184 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.