Protein Family IF06638
Metagenome
143
Members
45
Samples
143
Scaffolds
337.45
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_078286|Ga0466720_078286_4799_5851
- Length
- 330 aa
- Sequence
- MLKLFYAFKRRFPLLSYIINRLLTMAVMLFLLGLAVFGLMALAPGDIVDQIMMQQLFNENQGKAGQNTQSMSADQLAARRTELGLDQPFYVQYFRWLNRVIVHKDLGVSLISRAPVSFLIASRILNSLLLTKAGTKADIAVTFFALVLHAFPGLLLLILLQLFASVTGLFPVTAYPPFPFSSAPGKFVFSYAYHIFLPLLSAFLGGIGGSLRMIRATMLDQLGQPYITSLRSRGIAEWRVYFAHAFRNTLNPYITGSANLLASLFSGSLILEIIFAYPGIGRLMYEAVIQQDINLVLANIMFISFLVLVGMALADITLAFVDPRIRYGKE
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.7%
Kalotermitidae
31.8%
Rhinotermitidae
6.8%
Termopsidae
6.8%
Unclassified
4.5%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 43 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 44 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_020741 | 3300038395 | Bacteria | 8437 |
| 2 | Ga0466690_027904 | 3300042590 | Bacteria | 14673 |
| 3 | Ga0466691_110417 | 3300042593 | Unclassified | 3918 |
| 4 | Ga0466712_136902 | 3300042614 | Unclassified | 1820 |
| 5 | Ga0466711_147822 | 3300042615 | Bacteria | 14800 |
| 6 | Ga0466711_195729 | 3300042615 | Bacteria | 7978 |
| 7 | Ga0466726_023915 | 3300042619 | Bacteria | 4009 |
| 8 | Ga0466726_194419 | 3300042619 | Bacteria | 1545 |
| 9 | Ga0466728_117648 | 3300042620 | Bacteria | 2297 |
| 10 | Ga0466713_087932 | 3300042602 | Bacteria | 24748 |
| 11 | Ga0466735_023826 | 3300042624 | Bacteria | 1258 |
| 12 | Ga0466735_081745 | 3300042624 | Bacteria | 4258 |
| 13 | Ga0466702_014871 | 3300042635 | Bacteria | 2426 |
| 14 | Ga0466704_135364 | 3300042643 | Bacteria | 21022 |
| 15 | Ga0466704_186842 | 3300042643 | Bacteria | 4803 |
| 16 | Ga0466709_039391 | 3300042648 | Bacteria | 6346 |
| 17 | Ga0466708_050295 | 3300042652 | Bacteria | 6967 |
| 18 | Ga0466727_189356 | 3300042655 | Bacteria | 3947 |
| 19 | Ga0466727_316763 | 3300042655 | Bacteria | 1926 |
| 20 | Ga0466705_189797 | 3300042612 | Bacteria | 1843 |
| 21 | Ga0072941_1012753 | 3300005201 | Bacteria | 4450 |
| 22 | Ga0466699_261321 | 3300042597 | Bacteria | 20382 |
| 23 | Ga0466699_431616 | 3300042597 | Unclassified | 2791 |
| 24 | Ga0466711_177857 | 3300042615 | Bacteria | 15452 |
| 25 | Ga0466719_378931 | 3300042606 | Bacteria | 7120 |
| 26 | Ga0466719_471312 | 3300042606 | Bacteria | 5863 |
| 27 | Ga0466698_370851 | 3300042610 | Bacteria | 1119 |
| 28 | Ga0466703_142135 | 3300042636 | Bacteria | 5842 |
| 29 | Ga0466703_388433 | 3300042636 | Bacteria | 7699 |
| 30 | Ga0466703_401892 | 3300042636 | Unclassified | 4234 |
| 31 | Ga0466704_005288 | 3300042643 | Unclassified | 3524 |
| 32 | Ga0466704_015139 | 3300042643 | Bacteria | 23926 |
| 33 | Ga0466704_160634 | 3300042643 | Bacteria | 4052 |
| 34 | Ga0123353_10017986 | 3300010167 | Bacteria | 10425 |
| 35 | JGI24695J34938_10048746 | 3300002450 | Bacteria | 1864 |
| 36 | Ga0466690_303388 | 3300042590 | Unclassified | 2546 |
| 37 | Ga0466695_048447 | 3300042595 | Bacteria | 2407 |
| 38 | Ga0466695_091046 | 3300042595 | Bacteria | 29831 |
| 39 | Ga0466696_128276 | 3300042596 | Bacteria | 2462 |
| 40 | Ga0466699_131783 | 3300042597 | Bacteria | 5129 |
| 41 | Ga0466711_118585 | 3300042615 | Bacteria | 18452 |
| 42 | Ga0466715_018975 | 3300042616 | Bacteria | 15600 |
| 43 | Ga0466715_034205 | 3300042616 | Bacteria | 9019 |
| 44 | Ga0466728_094491 | 3300042620 | Bacteria | 4940 |
| 45 | Ga0466706_268257 | 3300042599 | Bacteria | 1175 |
| 46 | Ga0466713_084079 | 3300042602 | Bacteria | 7255 |
| 47 | Ga0466716_095696 | 3300042605 | Bacteria | 3349 |
| 48 | Ga0466719_261767 | 3300042606 | Bacteria | 7990 |
| 49 | Ga0466720_114307 | 3300042607 | Bacteria | 10177 |
| 50 | Ga0466735_198198 | 3300042624 | Bacteria | 1241 |
| 51 | Ga0466703_025379 | 3300042636 | Bacteria | 4392 |
| 52 | Ga0466708_060659 | 3300042652 | Bacteria | 41764 |
| 53 | Ga0466708_287990 | 3300042652 | Bacteria | 8109 |
| 54 | JGI24698J34947_10013600 | 3300002449 | Bacteria | 4440 |
| 55 | JGI24695J34938_10004750 | 3300002450 | Bacteria | 8787 |
| 56 | Ga0072941_1029351 | 3300005201 | Unclassified | 2647 |
| 57 | Ga0466692_108431 | 3300042591 | Bacteria | 1725 |
| 58 | Ga0466694_261424 | 3300042594 | Bacteria | 3102 |
| 59 | Ga0466712_204554 | 3300042614 | Bacteria | 1308 |
| 60 | Ga0466720_078286 | 3300042607 | Bacteria | 6031 |
| 61 | Ga0466722_014313 | 3300042609 | Bacteria | 18073 |
| 62 | Ga0466698_165920 | 3300042610 | Bacteria | 1785 |
| 63 | Ga0466703_131881 | 3300042636 | Bacteria | 5372 |
| 64 | Ga0466704_263754 | 3300042643 | Bacteria | 34688 |
| 65 | Ga0466704_280963 | 3300042643 | Bacteria | 68260 |
| 66 | Ga0466708_041094 | 3300042652 | Bacteria | 5559 |
| 67 | Ga0466708_054207 | 3300042652 | Bacteria | 41009 |
| 68 | Ga0466708_113067 | 3300042652 | Bacteria | 13827 |
| 69 | Ga0466705_098429 | 3300042612 | Bacteria | 17629 |
| 70 | Ga0466705_107386 | 3300042612 | Bacteria | 18231 |
| 71 | JGI24698J34947_10009339 | 3300002449 | Bacteria | 5384 |
| 72 | Ga0072940_1003848 | 3300005200 | Bacteria | 10584 |
| 73 | Ga0466690_307438 | 3300042590 | Bacteria | 1856 |
| 74 | Ga0466694_378342 | 3300042594 | Bacteria | 7063 |
| 75 | Ga0466705_457646 | 3300042612 | Bacteria | 9681 |
| 76 | Ga0466712_056266 | 3300042614 | Bacteria | 5791 |
| 77 | Ga0466711_031589 | 3300042615 | Bacteria | 25752 |
| 78 | Ga0466723_087220 | 3300042618 | Bacteria | 31531 |
| 79 | Ga0466714_032357 | 3300042603 | Bacteria | 6555 |
| 80 | Ga0466716_037150 | 3300042605 | Bacteria | 24586 |
| 81 | Ga0466722_034988 | 3300042609 | Bacteria | 8720 |
| 82 | Ga0466704_165994 | 3300042643 | Bacteria | 10133 |
| 83 | Ga0466709_272499 | 3300042648 | Bacteria | 4838 |
| 84 | Ga0466705_313908 | 3300042612 | Bacteria | 12359 |
| 85 | JGI24702J35022_10001126 | 3300002462 | Bacteria | 16611 |
| 86 | Ga0072941_1012020 | 3300005201 | Bacteria | 8500 |
| 87 | Ga0466691_094856 | 3300042593 | Bacteria | 4172 |
| 88 | Ga0466694_268603 | 3300042594 | Bacteria | 2940 |
| 89 | Ga0466696_104620 | 3300042596 | Bacteria | 4051 |
| 90 | Ga0466699_404314 | 3300042597 | Bacteria | 1719 |
| 91 | Ga0466712_223325 | 3300042614 | Bacteria | 3219 |
| 92 | Ga0466711_046724 | 3300042615 | Bacteria | 2470 |
| 93 | Ga0466723_278487 | 3300042618 | Bacteria | 24906 |
| 94 | Ga0466716_140375 | 3300042605 | Bacteria | 7378 |
| 95 | Ga0466716_479871 | 3300042605 | Unclassified | 1264 |
| 96 | Ga0466735_006643 | 3300042624 | Bacteria | 4172 |
| 97 | Ga0466703_169008 | 3300042636 | Bacteria | 16091 |
| 98 | Ga0466703_358345 | 3300042636 | Bacteria | 21053 |
| 99 | Ga0466704_511287 | 3300042643 | Bacteria | 48132 |
| 100 | Ga0466709_086528 | 3300042648 | Bacteria | 19291 |
| 101 | Ga0466705_035825 | 3300042612 | Bacteria | 6292 |
| 102 | Ga0466705_356724 | 3300042612 | Bacteria | 3123 |
| 103 | JGI24698J34947_10012710 | 3300002449 | Unclassified | 4610 |
| 104 | JGI24699J35502_11131640 | 3300002509 | Bacteria | 5881 |
| 105 | Ga0072941_1013252 | 3300005201 | Bacteria | 14327 |
| 106 | Ga0466691_205824 | 3300042593 | Unclassified | 2370 |
| 107 | Ga0466699_112293 | 3300042597 | Bacteria | 7832 |
| 108 | Ga0466699_181280 | 3300042597 | Bacteria | 13045 |
| 109 | Ga0466699_374690 | 3300042597 | Bacteria | 2616 |
| 110 | Ga0466711_248273 | 3300042615 | Bacteria | 54349 |
| 111 | Ga0466718_140413 | 3300042617 | Bacteria | 4550 |
| 112 | Ga0466723_069191 | 3300042618 | Bacteria | 3642 |
| 113 | Ga0466723_343537 | 3300042618 | Bacteria | 96271 |
| 114 | Ga0466726_271995 | 3300042619 | Bacteria | 5195 |
| 115 | Ga0466700_136446 | 3300042600 | Bacteria | 1566 |
| 116 | Ga0466707_133034 | 3300042601 | Bacteria | 1957 |
| 117 | Ga0466716_057198 | 3300042605 | Bacteria | 17932 |
| 118 | Ga0466719_214679 | 3300042606 | Bacteria | 2501 |
| 119 | Ga0466729_224768 | 3300042621 | Bacteria | 3968 |
| 120 | Ga0466731_228191 | 3300042622 | Bacteria | 23388 |
| 121 | Ga0466703_396836 | 3300042636 | Bacteria | 45272 |
| 122 | Ga0466704_214306 | 3300042643 | Bacteria | 6666 |
| 123 | Ga0466709_354828 | 3300042648 | Unclassified | 3050 |
| 124 | Ga0123357_10179008 | 3300009784 | Bacteria | 2482 |
| 125 | Ga0466705_189718 | 3300042612 | Bacteria | 4690 |
| 126 | Ga0466705_295958 | 3300042612 | Bacteria | 3360 |
| 127 | JGI24695J34938_10000008 | 3300002450 | Bacteria | 136681 |
| 128 | Ga0072940_1057463 | 3300005200 | Bacteria | 3313 |
| 129 | Ga0466693_318309 | 3300042592 | Bacteria | 3037 |
| 130 | Ga0466691_005277 | 3300042593 | Unclassified | 1371 |
| 131 | Ga0466691_146476 | 3300042593 | Bacteria | 7385 |
| 132 | Ga0466694_054085 | 3300042594 | Unclassified | 3648 |
| 133 | Ga0466699_243123 | 3300042597 | Bacteria | 2695 |
| 134 | Ga0466711_241309 | 3300042615 | Bacteria | 6581 |
| 135 | Ga0466715_595501 | 3300042616 | Unclassified | 5252 |
| 136 | Ga0466723_100058 | 3300042618 | Bacteria | 2068 |
| 137 | Ga0466723_274793 | 3300042618 | Bacteria | 4521 |
| 138 | Ga0466735_173961 | 3300042624 | Bacteria | 2108 |
| 139 | Ga0466703_094447 | 3300042636 | Bacteria | 8138 |
| 140 | Ga0466704_481028 | 3300042643 | Bacteria | 4196 |
| 141 | Ga0466709_148004 | 3300042648 | Bacteria | 1481 |
| 142 | Ga0466709_185927 | 3300042648 | Bacteria | 5321 |
| 143 | Ga0123356_10003147 | 3300010049 | Bacteria | 17376 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042619 | Ga0466726_023915 | Ga0466726_023915_1679_2698 | 310 |
| 2 | 3300042643 | Ga0466704_481028 | Ga0466704_481028_1569_2624 | 310 |
| 3 | 3300002449 | JGI24698J34947_10012710 | JGI24698J34947_100127102 | 311 |
| 4 | 3300042597 | Ga0466699_112293 | Ga0466699_112293_2563_3543 | 311 |
| 5 | 3300042597 | Ga0466699_431616 | Ga0466699_431616_318_1298 | 311 |
| 6 | 3300042610 | Ga0466698_165920 | Ga0466698_165920_56_1051 | 311 |
| 7 | 3300042594 | Ga0466694_268603 | Ga0466694_268603_737_1717 | 312 |
| 8 | 3300042597 | Ga0466699_374690 | Ga0466699_374690_1480_2460 | 312 |
| 9 | 3300042610 | Ga0466698_370851 | Ga0466698_370851_61_1041 | 312 |
| 10 | 3300042643 | Ga0466704_015139 | Ga0466704_015139_960_1958 | 312 |
| 11 | 3300009784 | Ga0123357_10179008 | Ga0123357_101790082 | 314 |
| 12 | 3300002450 | JGI24695J34938_10048746 | JGI24695J34938_100487461 | 315 |
| 13 | 3300042595 | Ga0466695_091046 | Ga0466695_091046_26962_28041 | 315 |
| 14 | 3300042593 | Ga0466691_005277 | Ga0466691_005277_362_1342 | 317 |
| 15 | 3300042615 | Ga0466711_195729 | Ga0466711_195729_4813_5883 | 317 |
| 16 | 3300042597 | Ga0466699_131783 | Ga0466699_131783_3979_4959 | 319 |
| 17 | 3300042597 | Ga0466699_404314 | Ga0466699_404314_676_1656 | 319 |
| 18 | 3300042636 | Ga0466703_169008 | Ga0466703_169008_9084_10070 | 319 |
| 19 | 3300005200 | Ga0072940_1003848 | Ga0072940_10038489 | 320 |
| 20 | 3300042594 | Ga0466694_261424 | Ga0466694_261424_74_1171 | 320 |
| 21 | 3300042606 | Ga0466719_378931 | Ga0466719_378931_4364_5353 | 320 |
| 22 | 3300042614 | Ga0466712_136902 | Ga0466712_136902_820_1800 | 321 |
| 23 | 3300042599 | Ga0466706_268257 | Ga0466706_268257_76_1089 | 322 |
| 24 | 3300042622 | Ga0466731_228191 | Ga0466731_228191_20411_21382 | 323 |
| 25 | 3300042594 | Ga0466694_378342 | Ga0466694_378342_3599_4696 | 324 |
| 26 | 3300042596 | Ga0466696_128276 | Ga0466696_128276_1331_2389 | 324 |
| 27 | 3300042635 | Ga0466702_014871 | Ga0466702_014871_1120_2205 | 324 |
| 28 | 3300002450 | JGI24695J34938_10000008 | JGI24695J34938_10000008134 | 325 |
| 29 | 3300042593 | Ga0466691_094856 | Ga0466691_094856_1964_2941 | 325 |
| 30 | 3300042600 | Ga0466700_136446 | Ga0466700_136446_540_1517 | 325 |
| 31 | 3300042620 | Ga0466728_117648 | Ga0466728_117648_811_1788 | 325 |
| 32 | 3300042597 | Ga0466699_181280 | Ga0466699_181280_7528_8508 | 326 |
| 33 | 3300042597 | Ga0466699_243123 | Ga0466699_243123_58_1038 | 326 |
| 34 | 3300042597 | Ga0466699_261321 | Ga0466699_261321_18854_19834 | 326 |
| 35 | 3300042605 | Ga0466716_095696 | Ga0466716_095696_2284_3267 | 327 |
| 36 | 3300005201 | Ga0072941_1013252 | Ga0072941_10132529 | 328 |
| 37 | 3300042624 | Ga0466735_006643 | Ga0466735_006643_1367_2476 | 328 |
| 38 | 3300042624 | Ga0466735_081745 | Ga0466735_081745_476_1462 | 328 |
| 39 | 3300042636 | Ga0466703_131881 | Ga0466703_131881_2784_3866 | 328 |
| 40 | 3300042636 | Ga0466703_401892 | Ga0466703_401892_1588_2634 | 328 |
| 41 | 3300042605 | Ga0466716_057198 | Ga0466716_057198_4215_5204 | 329 |
| 42 | 3300042612 | Ga0466705_356724 | Ga0466705_356724_1288_2277 | 329 |
| 43 | 3300042636 | Ga0466703_396836 | Ga0466703_396836_26751_27812 | 329 |
| 44 | 3300042652 | Ga0466708_113067 | Ga0466708_113067_10353_11342 | 329 |
| 45 | 3300042592 | Ga0466693_318309 | Ga0466693_318309_812_1903 | 330 |
| 46 | 3300042602 | Ga0466713_084079 | Ga0466713_084079_2562_3623 | 330 |
| 47 | 3300042607 | Ga0466720_078286 | Ga0466720_078286_4799_5851 | 330 |
| 48 | 3300042607 | Ga0466720_114307 | Ga0466720_114307_4818_5870 | 330 |
| 49 | 3300042615 | Ga0466711_031589 | Ga0466711_031589_19764_20849 | 330 |
| 50 | 3300042621 | Ga0466729_224768 | Ga0466729_224768_1079_2137 | 330 |
| 51 | 3300042606 | Ga0466719_214679 | Ga0466719_214679_681_1739 | 331 |
| 52 | 3300042618 | Ga0466723_278487 | Ga0466723_278487_3175_4224 | 331 |
| 53 | 3300042612 | Ga0466705_457646 | Ga0466705_457646_7892_8950 | 332 |
| 54 | 3300042615 | Ga0466711_147822 | Ga0466711_147822_1841_2938 | 332 |
| 55 | 3300042643 | Ga0466704_135364 | Ga0466704_135364_14476_15534 | 332 |
| 56 | 3300042648 | Ga0466709_272499 | Ga0466709_272499_1520_2578 | 332 |
| 57 | 3300042652 | Ga0466708_060659 | Ga0466708_060659_13023_14099 | 332 |
| 58 | 3300042593 | Ga0466691_205824 | Ga0466691_205824_1292_2344 | 333 |
| 59 | 3300042612 | Ga0466705_189718 | Ga0466705_189718_1128_2189 | 333 |
| 60 | 3300005200 | Ga0072940_1057463 | Ga0072940_10574632 | 335 |
| 61 | 3300042591 | Ga0466692_108431 | Ga0466692_108431_85_1143 | 335 |
| 62 | 3300042615 | Ga0466711_118585 | Ga0466711_118585_16120_17184 | 335 |
| 63 | 3300042636 | Ga0466703_388433 | Ga0466703_388433_1524_2606 | 335 |
| 64 | 3300042605 | Ga0466716_479871 | Ga0466716_479871_107_1195 | 336 |
| 65 | 3300042615 | Ga0466711_248273 | Ga0466711_248273_48148_49239 | 336 |
| 66 | 3300042648 | Ga0466709_185927 | Ga0466709_185927_2119_3204 | 336 |
| 67 | 3300010049 | Ga0123356_10003147 | Ga0123356_100031478 | 337 |
| 68 | 3300042605 | Ga0466716_037150 | Ga0466716_037150_22615_23700 | 337 |
| 69 | 3300042615 | Ga0466711_046724 | Ga0466711_046724_904_1992 | 337 |
| 70 | 3300042643 | Ga0466704_005288 | Ga0466704_005288_1813_2898 | 337 |
| 71 | 3300042648 | Ga0466709_148004 | Ga0466709_148004_36_1124 | 337 |
| 72 | 3300042612 | Ga0466705_295958 | Ga0466705_295958_1719_2804 | 338 |
| 73 | 3300042643 | Ga0466704_280963 | Ga0466704_280963_41600_42688 | 338 |
| 74 | 3300042655 | Ga0466727_316763 | Ga0466727_316763_433_1500 | 338 |
| 75 | 3300002449 | JGI24698J34947_10009339 | JGI24698J34947_100093392 | 339 |
| 76 | 3300042593 | Ga0466691_110417 | Ga0466691_110417_900_1976 | 339 |
| 77 | 3300042612 | Ga0466705_107386 | Ga0466705_107386_3132_4220 | 339 |
| 78 | 3300042612 | Ga0466705_313908 | Ga0466705_313908_5270_6358 | 339 |
| 79 | 3300042643 | Ga0466704_165994 | Ga0466704_165994_6213_7298 | 339 |
| 80 | 3300042643 | Ga0466704_263754 | Ga0466704_263754_28156_29244 | 339 |
| 81 | 3300002509 | JGI24699J35502_11131640 | JGI24699J35502_111316405 | 340 |
| 82 | 3300042590 | Ga0466690_027904 | Ga0466690_027904_6016_7104 | 340 |
| 83 | 3300042618 | Ga0466723_087220 | Ga0466723_087220_21125_22213 | 340 |
| 84 | 3300042593 | Ga0466691_146476 | Ga0466691_146476_4698_5780 | 341 |
| 85 | 3300042618 | Ga0466723_343537 | Ga0466723_343537_35903_36985 | 341 |
| 86 | 3300042636 | Ga0466703_358345 | Ga0466703_358345_3283_4362 | 341 |
| 87 | 3300042616 | Ga0466715_034205 | Ga0466715_034205_2114_3202 | 342 |
| 88 | 3300042624 | Ga0466735_023826 | Ga0466735_023826_93_1175 | 342 |
| 89 | 3300042606 | Ga0466719_471312 | Ga0466719_471312_1870_2964 | 343 |
| 90 | 3300042636 | Ga0466703_025379 | Ga0466703_025379_930_2015 | 343 |
| 91 | 3300042643 | Ga0466704_511287 | Ga0466704_511287_30991_32073 | 343 |
| 92 | 3300042655 | Ga0466727_189356 | Ga0466727_189356_1314_2405 | 343 |
| 93 | 3300005201 | Ga0072941_1012020 | Ga0072941_10120204 | 344 |
| 94 | 3300042594 | Ga0466694_054085 | Ga0466694_054085_551_1606 | 344 |
| 95 | 3300042612 | Ga0466705_189797 | Ga0466705_189797_71_1168 | 344 |
| 96 | 3300042614 | Ga0466712_223325 | Ga0466712_223325_1809_2894 | 344 |
| 97 | 3300042615 | Ga0466711_241309 | Ga0466711_241309_1307_2389 | 344 |
| 98 | 3300042619 | Ga0466726_194419 | Ga0466726_194419_61_1155 | 344 |
| 99 | 3300042595 | Ga0466695_048447 | Ga0466695_048447_655_1722 | 345 |
| 100 | 3300042602 | Ga0466713_087932 | Ga0466713_087932_19498_20583 | 345 |
| 101 | 3300042652 | Ga0466708_054207 | Ga0466708_054207_18500_19585 | 345 |
| 102 | 3300042590 | Ga0466690_307438 | Ga0466690_307438_473_1558 | 346 |
| 103 | 3300042609 | Ga0466722_034988 | Ga0466722_034988_4134_5222 | 346 |
| 104 | 3300042636 | Ga0466703_142135 | Ga0466703_142135_2858_3955 | 347 |
| 105 | 3300042648 | Ga0466709_086528 | Ga0466709_086528_176_1330 | 347 |
| 106 | 3300042652 | Ga0466708_287990 | Ga0466708_287990_5677_6762 | 347 |
| 107 | 3300042648 | Ga0466709_354828 | Ga0466709_354828_385_1485 | 348 |
| 108 | 3300002462 | JGI24702J35022_10001126 | JGI24702J35022_1000112613 | 349 |
| 109 | 3300042616 | Ga0466715_595501 | Ga0466715_595501_2693_3796 | 349 |
| 110 | 3300042617 | Ga0466718_140413 | Ga0466718_140413_123_1211 | 349 |
| 111 | 3300042652 | Ga0466708_041094 | Ga0466708_041094_2673_3788 | 349 |
| 112 | 3300042596 | Ga0466696_104620 | Ga0466696_104620_2582_3685 | 350 |
| 113 | 3300042652 | Ga0466708_050295 | Ga0466708_050295_3682_4782 | 350 |
| 114 | 3300010167 | Ga0123353_10017986 | Ga0123353_100179866 | 351 |
| 115 | 3300042612 | Ga0466705_098429 | Ga0466705_098429_15582_16679 | 351 |
| 116 | 3300042614 | Ga0466712_204554 | Ga0466712_204554_118_1227 | 351 |
| 117 | 3300042615 | Ga0466711_177857 | Ga0466711_177857_12020_13138 | 351 |
| 118 | 3300042601 | Ga0466707_133034 | Ga0466707_133034_213_1310 | 353 |
| 119 | 3300042624 | Ga0466735_198198 | Ga0466735_198198_128_1219 | 353 |
| 120 | 3300042643 | Ga0466704_160634 | Ga0466704_160634_1095_2198 | 353 |
| 121 | 3300038395 | Ga0415639_020741 | Ga0415639_020741_2562_3680 | 354 |
| 122 | 3300042606 | Ga0466719_261767 | Ga0466719_261767_2058_3155 | 354 |
| 123 | 3300042624 | Ga0466735_173961 | Ga0466735_173961_68_1162 | 354 |
| 124 | 3300002450 | JGI24695J34938_10004750 | JGI24695J34938_100047505 | 355 |
| 125 | 3300042618 | Ga0466723_274793 | Ga0466723_274793_2964_4085 | 355 |
| 126 | 3300042603 | Ga0466714_032357 | Ga0466714_032357_3968_5071 | 356 |
| 127 | 3300042614 | Ga0466712_056266 | Ga0466712_056266_4683_5768 | 356 |
| 128 | 3300042605 | Ga0466716_140375 | Ga0466716_140375_2041_3162 | 357 |
| 129 | 3300042612 | Ga0466705_035825 | Ga0466705_035825_1343_2464 | 357 |
| 130 | 3300042619 | Ga0466726_271995 | Ga0466726_271995_3010_4101 | 357 |
| 131 | 3300002449 | JGI24698J34947_10013600 | JGI24698J34947_100136002 | 358 |
| 132 | 3300005201 | Ga0072941_1012753 | Ga0072941_10127535 | 358 |
| 133 | 3300005201 | Ga0072941_1029351 | Ga0072941_10293511 | 358 |
| 134 | 3300042643 | Ga0466704_214306 | Ga0466704_214306_4285_5361 | 358 |
| 135 | 3300042590 | Ga0466690_303388 | Ga0466690_303388_567_1694 | 359 |
| 136 | 3300042618 | Ga0466723_100058 | Ga0466723_100058_95_1222 | 359 |
| 137 | 3300042620 | Ga0466728_094491 | Ga0466728_094491_2443_3570 | 360 |
| 138 | 3300042648 | Ga0466709_039391 | Ga0466709_039391_1868_2986 | 360 |
| 139 | 3300042616 | Ga0466715_018975 | Ga0466715_018975_12276_13361 | 361 |
| 140 | 3300042618 | Ga0466723_069191 | Ga0466723_069191_1523_2650 | 361 |
| 141 | 3300042636 | Ga0466703_094447 | Ga0466703_094447_3207_4334 | 364 |
| 142 | 3300042643 | Ga0466704_186842 | Ga0466704_186842_2510_3637 | 364 |
| 143 | 3300042609 | Ga0466722_014313 | Ga0466722_014313_2710_3924 | 387 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.48 | 0.54 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.