Protein Family IF06618

Metagenome Metatranscriptome Isolate
399 Members
166 Samples
312 Scaffolds
85.82 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_033681|Ga0466720_033681_460_768
Length
102 aa
Sequence
VQKRYLRKKVLIEVEIMTEERNRRKVRTGVVVSDKADKTITVSVQRQEVHPKYGKIIRLNKKYKAHDEKNESHIGDTVRIMETRPLSKTKCWRLVEIVEKAK

πŸ“Š Sample Types

Isolate 21.8%
Metagenome 76.9%
MAG 0.0%
Metatranscriptome 1.2%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 27.0%
Termitidae 24.5%
Apidae 12.3%
Blattidae 11.7%
Kalotermitidae 8.0%
Rhinotermitidae 3.1%
Termopsidae 2.5%
Drosophilidae 2.5%
Elmidae 1.8%
Passalidae 1.8%
Tenebrionidae 1.2%
Formicidae 0.6%
Hodotermitidae 0.6%
Daphniidae 0.6%
Culicidae 0.6%
Armadillidiidae 0.6%
Harpacticidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 355
Eukaryota 0
Viruses 0
Unclassified 44

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
2 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
3 2922326829 Bacteroides sp. 224 Isolate Blattidae
4 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
5 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
6 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
7 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
8 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
9 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
14 2882250448 Bizionia sp. APA-3 Isolate
15 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
16 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
17 2923982719 Parabacteroides sp. 52 Isolate Blattidae
18 2820873081 Unclassified Actinobacteria Lab288P1bin96 Isolate Unclassified
19 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
20 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
21 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
22 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
23 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
24 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
28 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
36 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
39 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
40 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
41 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
42 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
43 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
44 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
45 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
46 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
47 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
48 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
49 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
50 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
51 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
52 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
53 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
54 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
55 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
56 3004719924 Lactobacillus sp. W8174 Isolate Apidae
57 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
58 3300005319 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut Metagenome Drosophilidae
59 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
60 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
61 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
62 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
63 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
64 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
65 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
66 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
67 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
68 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
69 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
70 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
71 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
72 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
73 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
74 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
75 2785510743 Apibacter sp. ESL0404 Isolate Apidae
76 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
77 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
78 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
79 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
80 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
81 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
82 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
83 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
84 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
85 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
86 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
87 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
88 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
89 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
90 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
91 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
92 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
93 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
94 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
95 2864836148 Arcicella rosea S00070 Isolate Elmidae
96 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
97 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
98 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
99 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
100 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
101 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
102 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
103 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
104 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
105 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
106 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
107 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
108 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
109 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
110 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
111 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
112 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
113 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
114 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
115 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
116 3004677695 Bacteroides sp. 214 Isolate Blattidae
117 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
118 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
119 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
120 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
121 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
122 3300021240 Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA Metatranscriptome Termitidae
123 3300023282 Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA Metatranscriptome Termitidae
124 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
125 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
126 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
127 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
128 2832298047 Apibacter sp. wkB309 Isolate Apidae
129 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
130 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
131 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
132 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
133 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
134 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
135 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
136 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
137 2021593000 Sample 264 Metagenome Harpacticidae
138 3004672520 Bacteroides sp. 51 Isolate Blattidae
139 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
140 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
141 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
142 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
143 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
144 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
145 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
146 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
147 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
148 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
149 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
150 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
151 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
152 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
153 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
154 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
155 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
156 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
157 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
158 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
159 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
160 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
161 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
162 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
163 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
164 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
165 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
166 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_150762 3300042611 Bacteria 1109
2 Ga0466732_141961 3300042656 Unclassified 4820
3 Ga0466733_132245 3300042659 Bacteria 2692
4 Ga0255809_1015644 3300022820 Unclassified 557
5 Ga0264413_138535 3300024493 Unclassified 14446
6 Ga0466690_168212 3300042590 Bacteria 11803
7 Ga0466693_175010 3300042592 Bacteria 10069
8 Ga0466691_204814 3300042593 Bacteria 23707
9 Ga0466695_112952 3300042595 Bacteria 2140
10 Ga0466695_394828 3300042595 Bacteria 6915
11 Ga0466706_123047 3300042599 Bacteria 432554
12 Ga0466706_198004 3300042599 Bacteria 4840
13 Ga0466700_058068 3300042600 Bacteria 2019
14 Ga0466707_315151 3300042601 Bacteria 79442
15 Ga0466714_088188 3300042603 Bacteria 2351
16 Ga0466714_137899 3300042603 Unclassified 4179
17 Ga0466717_033155 3300042604 Bacteria 1231
18 Ga0466722_161726 3300042609 Bacteria 14778
19 Ga0466698_105271 3300042610 Bacteria 33608
20 Ga0466731_050866 3300042622 Bacteria 13115
21 Ga0466731_370304 3300042622 Bacteria 1271
22 Ga0466735_027088 3300042624 Bacteria 1487
23 Ga0466735_177951 3300042624 Bacteria 10162
24 Ga0466702_406892 3300042635 Bacteria 4112
25 Ga0466704_051937 3300042643 Bacteria 1091
26 Ga0123356_10073866 3300010049 Bacteria 3208
27 Ga0123356_12150010 3300010049 Bacteria 697
28 Ga0123353_10820437 3300010167 Unclassified 1281
29 Ga0123353_10870821 3300010167 Bacteria 1231
30 Ga0466705_525713 3300042612 Bacteria 1726
31 Ga0466715_016723 3300042616 Bacteria 13247
32 Ga0466718_119526 3300042617 Bacteria 1899
33 Ga0466723_058528 3300042618 Bacteria 28595
34 JGI24698J34947_10000555 3300002449 Bacteria 17744
35 JGI24695J34938_10003848 3300002450 Bacteria 10185
36 JGI24702J35022_10022268 3300002462 Bacteria 3432
37 JGI24702J35022_10023308 3300002462 Bacteria 3347
38 JGI24702J35022_10430787 3300002462 Bacteria 801
39 JGI24705J35276_12214984 3300002504 Bacteria 1983
40 Ga0105005_1046106 3300007505 Bacteria 1473
41 Ga0466705_222636 3300042612 Bacteria 3771
42 Ga0466733_052339 3300042659 Bacteria 35317
43 Ga0264413_160442 3300024493 Unclassified 982
44 Ga0466657_367532 3300042582 Unclassified 1171
45 Ga0466657_396906 3300042582 Bacteria 1226
46 Ga0466690_287618 3300042590 Bacteria 16965
47 Ga0466694_006142 3300042594 Bacteria 1075
48 Ga0466694_145437 3300042594 Unclassified 1026
49 Ga0466695_272796 3300042595 Bacteria 4403
50 Ga0466699_227137 3300042597 Unclassified 1483
51 Ga0466699_243824 3300042597 Bacteria 3177
52 Ga0466717_090799 3300042604 Bacteria 1304
53 Ga0466716_421833 3300042605 Bacteria 2093
54 Ga0466721_149392 3300042608 Unclassified 1131
55 Ga0466722_086030 3300042609 Bacteria 5720
56 Ga0466698_439910 3300042610 Bacteria 1160
57 Ga0466734_063656 3300042623 Bacteria 2735
58 Ga0466735_152196 3300042624 Bacteria 3972
59 Ga0466735_164481 3300042624 Bacteria 11213
60 Ga0466735_166733 3300042624 Unclassified 1570
61 Ga0466730_084715 3300042625 Bacteria 2994
62 Ga0466702_229598 3300042635 Bacteria 1647
63 Ga0466704_541626 3300042643 Bacteria 3198
64 Ga0466709_406939 3300042648 Bacteria 144693
65 Ga0466725_021933 3300042654 Bacteria 1077
66 Ga0466725_213877 3300042654 Bacteria 2875
67 Ga0123356_10824572 3300010049 Bacteria 1099
68 Ga0466715_045203 3300042616 Bacteria 21834
69 Ga0466723_196307 3300042618 Bacteria 2425
70 Ga0466723_198099 3300042618 Bacteria 9283
71 Ga0466728_294355 3300042620 Bacteria 3426
72 2227606019 2225789004 Bacteria 2298
73 IMNBL1DRAFT_c0007028 3300000062 Bacteria 6005
74 JGI24695J34938_10039258 3300002450 Bacteria 2140
75 JGI24702J35022_10000547 3300002462 Bacteria 22726
76 JGI24702J35022_10020509 3300002462 Bacteria 3587
77 Ga0068305_10002308 3300005083 Bacteria 45236
78 Ga0068305_10026156 3300005083 Bacteria 20761
79 Ga0466697_129165 3300042611 Bacteria 1022
80 Ga0466697_240388 3300042611 Bacteria 1604
81 Ga0466733_062198 3300042659 Bacteria 1235
82 Ga0160460_100001 3300012845 Bacteria 905098
83 Ga0255809_1020061 3300022820 Unclassified 548
84 Ga0255808_1004113 3300023282 Bacteria 1516
85 Ga0466694_170101 3300042594 Unclassified 1382
86 Ga0466696_206041 3300042596 Bacteria 1521
87 Ga0466696_367210 3300042596 Bacteria 9324
88 Ga0466707_398960 3300042601 Bacteria 15809
89 Ga0466713_137191 3300042602 Bacteria 44160
90 Ga0466698_062035 3300042610 Bacteria 1945
91 Ga0466698_248722 3300042610 Bacteria 1594
92 Ga0466697_012625 3300042611 Bacteria 1136
93 Ga0466731_316999 3300042622 Bacteria 1703
94 Ga0466734_102724 3300042623 Bacteria 2099
95 Ga0466735_172430 3300042624 Bacteria 13043
96 Ga0466735_180421 3300042624 Bacteria 2530
97 Ga0466703_083810 3300042636 Unclassified 2288
98 Ga0466724_39918 3300042649 Bacteria 1216
99 Ga0123357_10316724 3300009784 Unclassified 1548
100 Ga0123356_10441924 3300010049 Bacteria 1447
101 Ga0123356_11153446 3300010049 Bacteria 942
102 Ga0123353_10062736 3300010167 Bacteria 5960
103 Ga0123353_10076527 3300010167 Bacteria 5377
104 Ga0123353_11666204 3300010167 Bacteria 801
105 Ga0466710_181731 3300042613 Bacteria 1152
106 Ga0466711_289238 3300042615 Bacteria 45865
107 Ga0466723_027283 3300042618 Bacteria 8488
108 Ga0466729_114753 3300042621 Bacteria 4530
109 2227073312 2225789003 Bacteria 2462
110 IMNBL1DRAFT_c0000687 3300000062 Bacteria 27159
111 IMNBL1DRAFT_c0022374 3300000062 Bacteria 2503
112 IMNBL1DRAFT_c0143729 3300000062 Unclassified 615
113 JGI24698J34947_10043085 3300002449 Bacteria 2315
114 JGI24698J34947_10051090 3300002449 Bacteria 2081
115 Ga0072941_1219958 3300005201 Bacteria 2247
116 Ga0074304_1139657 3300005319 Bacteria 1821
117 Ga0103267_1000167 3300007190 Bacteria 33708
118 Ga0466733_122413 3300042659 Bacteria 26318
119 Ga0264413_160170 3300024493 Bacteria 2721
120 Ga0415639_246410 3300038395 Bacteria 1476
121 Ga0466656_221111 3300042550 Bacteria 1253
122 Ga0466690_136616 3300042590 Bacteria 29160
123 Ga0466692_194374 3300042591 Unclassified 2038
124 Ga0466693_068969 3300042592 Bacteria 6191
125 Ga0466694_385058 3300042594 Bacteria 6267
126 Ga0466696_466695 3300042596 Bacteria 1016
127 Ga0466699_221782 3300042597 Bacteria 1016
128 Ga0466701_068382 3300042598 Unclassified 3382
129 Ga0466707_194386 3300042601 Bacteria 27039
130 Ga0466713_096596 3300042602 Bacteria 406546
131 Ga0466698_113235 3300042610 Bacteria 1753
132 Ga0466729_310854 3300042621 Bacteria 3061
133 Ga0466735_174105 3300042624 Unclassified 1137
134 Ga0466735_207348 3300042624 Bacteria 2404
135 Ga0466735_221794 3300042624 Bacteria 2360
136 Ga0466703_109702 3300042636 Bacteria 21153
137 Ga0466703_388735 3300042636 Bacteria 2070
138 Ga0466709_083357 3300042648 Bacteria 39489
139 Ga0466727_230520 3300042655 Bacteria 1042
140 Ga0123357_10030639 3300009784 Bacteria 7293
141 Ga0123355_10301947 3300009826 Bacteria 2181
142 Ga0123356_10020898 3300010049 Bacteria 6193
143 Ga0123356_11972080 3300010049 Unclassified 728
144 Ga0466710_038969 3300042613 Bacteria 1095
145 Ga0466711_373674 3300042615 Bacteria 10875
146 Ga0466715_128269 3300042616 Bacteria 2365
147 Ga0466726_144476 3300042619 Bacteria 21004
148 IMNBL1DRAFT_c0032731 3300000062 Bacteria 1871
149 JGI24702J35022_10008763 3300002462 Bacteria 5711
150 Ga0068302_10187713 3300005071 Bacteria 5235
151 Ga0104040_1000171 3300007149 Bacteria 2406
152 Ga0466697_171567 3300042611 Bacteria 2992
153 Ga0466697_222388 3300042611 Unclassified 1530
154 Ga0466697_271579 3300042611 Bacteria 1199
155 Ga0466733_013347 3300042659 Bacteria 6976
156 Ga0466733_188673 3300042659 Unclassified 7150
157 Ga0466656_013690 3300042550 Unclassified 1236
158 Ga0466657_388915 3300042582 Bacteria 3645
159 Ga0466694_003944 3300042594 Bacteria 1725
160 Ga0466701_036012 3300042598 Bacteria 5947
161 Ga0466701_036305 3300042598 Bacteria 2727
162 Ga0466701_038225 3300042598 Bacteria 12164
163 Ga0466701_060634 3300042598 Bacteria 3386
164 Ga0466701_087824 3300042598 Unclassified 1005
165 Ga0466707_098650 3300042601 Bacteria 10173
166 Ga0466713_027800 3300042602 Bacteria 40167
167 Ga0466720_033681 3300042607 Bacteria 2172
168 Ga0466722_073972 3300042609 Bacteria 128406
169 Ga0466729_226506 3300042621 Bacteria 10868
170 Ga0466734_158837 3300042623 Bacteria 1241
171 Ga0466735_199067 3300042624 Bacteria 3377
172 Ga0466725_255972 3300042654 Bacteria 39464
173 Ga0123356_10020734 3300010049 Bacteria 6216
174 Ga0123356_10531087 3300010049 Bacteria 1336
175 Ga0123353_10367522 3300010167 Bacteria 2158
176 Ga0123353_10392289 3300010167 Bacteria 2070
177 Ga0123354_10210181 3300010882 Bacteria 2106
178 Ga0123354_10225873 3300010882 Bacteria 1973
179 Ga0466710_360371 3300042613 Bacteria 5191
180 Ga0466710_435809 3300042613 Bacteria 3899
181 Ga0466711_103283 3300042615 Bacteria 1814
182 Ga0466715_025469 3300042616 Bacteria 20577
183 Ga0466718_062717 3300042617 Bacteria 1007
184 Ga0466726_242160 3300042619 Bacteria 13880
185 Ga0466729_117205 3300042621 Bacteria 50557
186 2227071638 2225789003 Bacteria 2600
187 2227256381 2225789004 Bacteria 1308
188 2227491320 2225789004 Bacteria 4075
189 IMNBL1DRAFT_c0001224 3300000062 Bacteria 19401
190 IMNBL1DRAFT_c0058981 3300000062 Bacteria 1163
191 JGI24702J35022_10015899 3300002462 Bacteria 4132
192 JGI24702J35022_10476861 3300002462 Bacteria 763
193 JGI24702J35022_10483191 3300002462 Bacteria 758
194 Ga0068302_10124393 3300005071 Bacteria 5305
195 Ga0074278_136834 3300005721 Bacteria 1360
196 Ga0103267_1000475 3300007190 Bacteria 22560
197 Ga0466733_042896 3300042659 Unclassified 1702
198 Ga0466733_177289 3300042659 Unclassified 1004
199 Ga0264413_158905 3300024493 Bacteria 1879
200 Ga0466693_078533 3300042592 Bacteria 2944
201 Ga0466696_005318 3300042596 Bacteria 52289
202 Ga0466706_051732 3300042599 Bacteria 31564
203 Ga0466706_183911 3300042599 Bacteria 19618
204 Ga0466713_007584 3300042602 Bacteria 12665
205 Ga0466713_018853 3300042602 Bacteria 13634
206 Ga0466713_030797 3300042602 Bacteria 38314
207 Ga0466714_035260 3300042603 Bacteria 6508
208 Ga0466719_152619 3300042606 Bacteria 6002
209 Ga0466719_381451 3300042606 Bacteria 3784
210 Ga0466720_051698 3300042607 Bacteria 1551
211 Ga0466720_119454 3300042607 Bacteria 1177
212 Ga0466735_034406 3300042624 Bacteria 4957
213 Ga0466735_069412 3300042624 Bacteria 1697
214 Ga0466704_477103 3300042643 Bacteria 9640
215 Ga0466724_68043 3300042649 Bacteria 1234
216 Ga0466727_050462 3300042655 Bacteria 20965
217 Ga0123355_10194254 3300009826 Bacteria 2980
218 Ga0123356_10069677 3300010049 Bacteria 3298
219 Ga0123356_10115768 3300010049 Bacteria 2598
220 Ga0123356_11703014 3300010049 Unclassified 782
221 Ga0123356_13331084 3300010049 Unclassified 558
222 Ga0123353_10000175 3300010167 Bacteria 81609
223 Ga0123353_11160268 3300010167 Unclassified 1018
224 Ga0123353_12525121 3300010167 Unclassified 610
225 Ga0123354_10352651 3300010882 Unclassified 1309
226 Ga0466710_087835 3300042613 Bacteria 1266
227 Ga0466715_233174 3300042616 Bacteria 1175
228 Ga0466726_037110 3300042619 Bacteria 18134
229 TM1208_contig56605 2021593000 Bacteria 855
230 JGI24702J35022_10000840 3300002462 Bacteria 18966
231 JGI24696J40584_12814696 3300002834 Unclassified 895
232 Ga0123357_10000330 3300009784 Bacteria 44905
233 Ga0466697_074154 3300042611 Unclassified 1328
234 Ga0466732_436750 3300042656 Bacteria 1695
235 Ga0466733_169758 3300042659 Bacteria 1193
236 Ga0160443_100370 3300012848 Bacteria 37848
237 Ga0223684_1051054 3300021240 Bacteria 608
238 Ga0466657_360416 3300042582 Bacteria 25893
239 Ga0466690_085991 3300042590 Bacteria 12516
240 Ga0466690_147457 3300042590 Bacteria 20788
241 Ga0466692_137912 3300042591 Bacteria 2313
242 Ga0466695_330118 3300042595 Bacteria 3346
243 Ga0466696_199358 3300042596 Bacteria 7259
244 Ga0466696_247964 3300042596 Bacteria 1348
245 Ga0466696_258996 3300042596 Bacteria 2499
246 Ga0466706_218384 3300042599 Bacteria 1982
247 Ga0466706_228754 3300042599 Bacteria 25710
248 Ga0466713_017440 3300042602 Bacteria 108493
249 Ga0466714_061452 3300042603 Bacteria 2603
250 Ga0466717_235136 3300042604 Unclassified 1031
251 Ga0466722_256378 3300042609 Bacteria 7727
252 Ga0466698_327264 3300042610 Bacteria 8551
253 Ga0466698_392141 3300042610 Bacteria 2397
254 Ga0466731_294011 3300042622 Bacteria 4113
255 Ga0466735_014487 3300042624 Bacteria 7098
256 Ga0466702_138136 3300042635 Unclassified 1906
257 Ga0466703_073446 3300042636 Bacteria 8423
258 Ga0466703_367008 3300042636 Bacteria 30950
259 Ga0466725_237462 3300042654 Unclassified 1136
260 Ga0123357_10473530 3300009784 Bacteria 1065
261 Ga0123355_10098764 3300009826 Bacteria 4603
262 Ga0123356_10118653 3300010049 Bacteria 2569
263 Ga0123353_10000124 3300010167 Bacteria 92555
264 Ga0123353_11012372 3300010167 Unclassified 1115
265 Ga0123353_11325684 3300010167 Bacteria 932
266 Ga0123354_10001124 3300010882 Bacteria 31160
267 Ga0123354_10335090 3300010882 Bacteria 1373
268 Ga0466710_153421 3300042613 Bacteria 1718
269 Ga0466710_319466 3300042613 Bacteria 1153
270 Ga0466711_464836 3300042615 Bacteria 36759
271 Ga0466715_209992 3300042616 Bacteria 7477
272 IMNBL1DRAFT_c0004898 3300000062 Bacteria 7855
273 JGI24702J35022_10078783 3300002462 Bacteria 1783
274 JGI24702J35022_10098556 3300002462 Bacteria 1598
275 JGI24702J35022_10925438 3300002462 Unclassified 543
276 JGI24705J35276_12054925 3300002504 Bacteria 925
277 JGI24699J35502_11134150 3300002509 Bacteria 37878
278 JGI24696J40584_12858116 3300002834 Unclassified 1002
279 Ga0068305_10001103 3300005083 Bacteria 12271
280 Ga0068305_10200441 3300005083 Bacteria 1096
281 Ga0466733_091282 3300042659 Bacteria 1842
282 Ga0466733_220977 3300042659 Bacteria 23380
283 Ga0562377_0004 3300056842 Bacteria 3525959
284 Ga0233288_1000587 3300022232 Bacteria 3311
285 Ga0466656_294116 3300042550 Bacteria 2279
286 Ga0466696_466060 3300042596 Bacteria 1015
287 Ga0466700_396847 3300042600 Unclassified 3504
288 Ga0466713_052484 3300042602 Bacteria 51192
289 Ga0466714_113690 3300042603 Bacteria 1554
290 Ga0466721_140437 3300042608 Bacteria 2512
291 Ga0466735_017392 3300042624 Bacteria 4485
292 Ga0466703_352292 3300042636 Bacteria 1489
293 Ga0466704_134293 3300042643 Bacteria 13368
294 Ga0466724_68870 3300042649 Bacteria 1283
295 Ga0123355_10000469 3300009826 Bacteria 53443
296 Ga0123355_10002506 3300009826 Bacteria 26020
297 Ga0123356_10202491 3300010049 Bacteria 2026
298 Ga0123356_11664197 3300010049 Unclassified 791
299 Ga0123356_12013372 3300010049 Unclassified 720
300 Ga0123353_10609944 3300010167 Bacteria 1557
301 Ga0123354_10000498 3300010882 Bacteria 39457
302 Ga0466715_154449 3300042616 Bacteria 23802
303 Ga0466715_595690 3300042616 Bacteria 7812
304 Ga0466718_146676 3300042617 Bacteria 4038
305 IMNBL1DRAFT_c0049412 3300000062 Bacteria 1341
306 JGI24702J35022_10002652 3300002462 Bacteria 10856
307 JGI24702J35022_10081541 3300002462 Unclassified 1753
308 JGI24702J35022_10427277 3300002462 Bacteria 804
309 JGI24702J35022_10807958 3300002462 Bacteria 584
310 JGI24696J40584_12431188 3300002834 Bacteria 567
311 Ga0104048_1024507 3300007143 Bacteria 1811
312 Ga0104048_1169657 3300007143 Unclassified 1944

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042598 Ga0466701_036305 Ga0466701_036305_852_1103 83
2 2225789003 2227071638 2227433890 84
3 2225789003 2227073312 2227436897 84
4 3300023282 Ga0255808_1004113 Ga0255808_10041133 84
5 3300024493 Ga0264413_158905 Ga0264413_1589053 84
6 3300038395 Ga0415639_246410 Ga0415639_246410_487_741 84
7 3300042550 Ga0466656_013690 Ga0466656_013690_200_454 84
8 3300042591 Ga0466692_194374 Ga0466692_194374_1513_1767 84
9 3300042592 Ga0466693_068969 Ga0466693_068969_4783_5037 84
10 3300042592 Ga0466693_175010 Ga0466693_175010_159_413 84
11 3300042594 Ga0466694_003944 Ga0466694_003944_1009_1263 84
12 3300042594 Ga0466694_385058 Ga0466694_385058_1046_1300 84
13 3300042595 Ga0466695_112952 Ga0466695_112952_1832_2086 84
14 3300042595 Ga0466695_394828 Ga0466695_394828_3794_4048 84
15 3300042596 Ga0466696_005318 Ga0466696_005318_28889_29143 84
16 3300042596 Ga0466696_199358 Ga0466696_199358_4992_5246 84
17 3300042597 Ga0466699_221782 Ga0466699_221782_77_331 84
18 3300042597 Ga0466699_243824 Ga0466699_243824_846_1100 84
19 3300042599 Ga0466706_123047 Ga0466706_123047_25948_26202 84
20 3300042599 Ga0466706_198004 Ga0466706_198004_2516_2770 84
21 3300042599 Ga0466706_228754 Ga0466706_228754_9235_9489 84
22 3300042600 Ga0466700_058068 Ga0466700_058068_1607_1861 84
23 3300042600 Ga0466700_396847 Ga0466700_396847_3216_3470 84
24 3300042602 Ga0466713_007584 Ga0466713_007584_4131_4385 84
25 3300042602 Ga0466713_052484 Ga0466713_052484_40366_40620 84
26 3300042602 Ga0466713_137191 Ga0466713_137191_10147_10401 84
27 3300042603 Ga0466714_035260 Ga0466714_035260_2489_2743 84
28 3300042603 Ga0466714_061452 Ga0466714_061452_680_934 84
29 3300042603 Ga0466714_088188 Ga0466714_088188_277_531 84
30 3300042603 Ga0466714_113690 Ga0466714_113690_1091_1345 84
31 3300042603 Ga0466714_137899 Ga0466714_137899_60_314 84
32 3300042607 Ga0466720_051698 Ga0466720_051698_1258_1512 84
33 3300042608 Ga0466721_140437 Ga0466721_140437_1349_1603 84
34 3300042609 Ga0466722_086030 Ga0466722_086030_1332_1586 84
35 3300042610 Ga0466698_062035 Ga0466698_062035_1245_1499 84
36 3300042611 Ga0466697_271579 Ga0466697_271579_904_1158 84
37 3300042613 Ga0466710_360371 Ga0466710_360371_1711_1965 84
38 3300042615 Ga0466711_373674 Ga0466711_373674_324_578 84
39 3300042619 Ga0466726_037110 Ga0466726_037110_8056_8310 84
40 3300042621 Ga0466729_310854 Ga0466729_310854_2045_2299 84
41 3300042622 Ga0466731_050866 Ga0466731_050866_7294_7548 84
42 3300042622 Ga0466731_294011 Ga0466731_294011_2024_2278 84
43 3300042623 Ga0466734_102724 Ga0466734_102724_1438_1692 84
44 3300042624 Ga0466735_034406 Ga0466735_034406_2060_2314 84
45 3300042636 Ga0466703_352292 Ga0466703_352292_1183_1437 84
46 3300042648 Ga0466709_406939 Ga0466709_406939_132069_132323 84
47 3300042654 Ga0466725_021933 Ga0466725_021933_603_857 84
48 3300042656 Ga0466732_436750 Ga0466732_436750_277_531 84
49 3300042659 Ga0466733_013347 Ga0466733_013347_4324_4578 84
50 iso_pr_bacteria 2785510743 2785734806 84
51 iso_pr_bacteria 2799112231 2799232748 84
52 iso_pr_bacteria 2820277137 2820277332 84
53 iso_pr_bacteria 2820495292 2820495328 84
54 iso_pr_bacteria 2820507989 2820510397 84
55 iso_pr_bacteria 2820671341 2820672527 84
56 iso_pr_bacteria 2820765201 2820765251 84
57 iso_pr_bacteria 2820770630 2820771389 84
58 iso_pr_bacteria 2820785563 2820786950 84
59 iso_pr_bacteria 2820788205 2820789834 84
60 iso_pr_bacteria 2832298047 2832300082 84
61 2225789004 2227491320 2227963787 85
62 2225789004 2227606019 2228174978 85
63 3300000062 IMNBL1DRAFT_c0007028 IMNBL1DRAFT_00070284 85
64 3300000062 IMNBL1DRAFT_c0032731 IMNBL1DRAFT_00327313 85
65 3300002450 JGI24695J34938_10003848 JGI24695J34938_1000384814 85
66 3300002450 JGI24695J34938_10039258 JGI24695J34938_100392583 85
67 3300002462 JGI24702J35022_10020509 JGI24702J35022_100205097 85
68 3300002462 JGI24702J35022_10925438 JGI24702J35022_109254382 85
69 3300005083 Ga0068305_10002308 Ga0068305_1000230834 85
70 3300007143 Ga0104048_1024507 Ga0104048_10245074 85
71 3300007143 Ga0104048_1169657 Ga0104048_11696574 85
72 3300009826 Ga0123355_10000469 Ga0123355_100004692 85
73 3300009826 Ga0123355_10002506 Ga0123355_1000250621 85
74 3300009826 Ga0123355_10098764 Ga0123355_1009876410 85
75 3300009826 Ga0123355_10194254 Ga0123355_101942541 85
76 3300009826 Ga0123355_10301947 Ga0123355_103019474 85
77 3300010049 Ga0123356_10118653 Ga0123356_101186532 85
78 3300010049 Ga0123356_10202491 Ga0123356_102024913 85
79 3300010049 Ga0123356_11664197 Ga0123356_116641971 85
80 3300010049 Ga0123356_12150010 Ga0123356_121500101 85
81 3300010167 Ga0123353_10000175 Ga0123353_1000017538 85
82 3300010167 Ga0123353_10062736 Ga0123353_1006273612 85
83 3300010167 Ga0123353_10820437 Ga0123353_108204372 85
84 3300010167 Ga0123353_11160268 Ga0123353_111602681 85
85 3300010167 Ga0123353_12525121 Ga0123353_125251212 85
86 3300010882 Ga0123354_10210181 Ga0123354_102101814 85
87 3300010882 Ga0123354_10225873 Ga0123354_102258733 85
88 3300024493 Ga0264413_160442 Ga0264413_1604423 85
89 3300042550 Ga0466656_221111 Ga0466656_221111_351_608 85
90 3300042550 Ga0466656_294116 Ga0466656_294116_1671_1928 85
91 3300042582 Ga0466657_360416 Ga0466657_360416_22258_22515 85
92 3300042582 Ga0466657_367532 Ga0466657_367532_403_660 85
93 3300042582 Ga0466657_388915 Ga0466657_388915_3363_3620 85
94 3300042582 Ga0466657_396906 Ga0466657_396906_565_822 85
95 3300042590 Ga0466690_085991 Ga0466690_085991_8489_8746 85
96 3300042590 Ga0466690_287618 Ga0466690_287618_11640_11897 85
97 3300042591 Ga0466692_137912 Ga0466692_137912_748_1005 85
98 3300042594 Ga0466694_145437 Ga0466694_145437_47_304 85
99 3300042595 Ga0466695_272796 Ga0466695_272796_841_1098 85
100 3300042596 Ga0466696_206041 Ga0466696_206041_311_568 85
101 3300042596 Ga0466696_258996 Ga0466696_258996_415_672 85
102 3300042596 Ga0466696_367210 Ga0466696_367210_2018_2275 85
103 3300042597 Ga0466699_227137 Ga0466699_227137_757_1014 85
104 3300042598 Ga0466701_036012 Ga0466701_036012_1613_1870 85
105 3300042598 Ga0466701_038225 Ga0466701_038225_11324_11581 85
106 3300042598 Ga0466701_060634 Ga0466701_060634_631_888 85
107 3300042598 Ga0466701_068382 Ga0466701_068382_630_887 85
108 3300042598 Ga0466701_087824 Ga0466701_087824_291_548 85
109 3300042599 Ga0466706_051732 Ga0466706_051732_15726_15983 85
110 3300042599 Ga0466706_183911 Ga0466706_183911_18110_18367 85
111 3300042599 Ga0466706_218384 Ga0466706_218384_1263_1520 85
112 3300042601 Ga0466707_098650 Ga0466707_098650_4056_4313 85
113 3300042601 Ga0466707_194386 Ga0466707_194386_8990_9247 85
114 3300042601 Ga0466707_398960 Ga0466707_398960_3243_3500 85
115 3300042602 Ga0466713_017440 Ga0466713_017440_105210_105467 85
116 3300042602 Ga0466713_018853 Ga0466713_018853_1130_1387 85
117 3300042602 Ga0466713_030797 Ga0466713_030797_35034_35291 85
118 3300042602 Ga0466713_096596 Ga0466713_096596_317526_317783 85
119 3300042604 Ga0466717_033155 Ga0466717_033155_458_715 85
120 3300042604 Ga0466717_090799 Ga0466717_090799_426_683 85
121 3300042604 Ga0466717_235136 Ga0466717_235136_223_480 85
122 3300042605 Ga0466716_421833 Ga0466716_421833_11_268 85
123 3300042606 Ga0466719_152619 Ga0466719_152619_5039_5296 85
124 3300042606 Ga0466719_381451 Ga0466719_381451_1566_1823 85
125 3300042607 Ga0466720_119454 Ga0466720_119454_522_779 85
126 3300042609 Ga0466722_161726 Ga0466722_161726_8130_8387 85
127 3300042609 Ga0466722_256378 Ga0466722_256378_3196_3453 85
128 3300042610 Ga0466698_248722 Ga0466698_248722_405_662 85
129 3300042610 Ga0466698_327264 Ga0466698_327264_2841_3098 85
130 3300042610 Ga0466698_392141 Ga0466698_392141_404_661 85
131 3300042611 Ga0466697_012625 Ga0466697_012625_505_762 85
132 3300042611 Ga0466697_074154 Ga0466697_074154_963_1220 85
133 3300042611 Ga0466697_129165 Ga0466697_129165_261_518 85
134 3300042611 Ga0466697_150762 Ga0466697_150762_36_293 85
135 3300042611 Ga0466697_171567 Ga0466697_171567_2331_2588 85
136 3300042611 Ga0466697_222388 Ga0466697_222388_796_1053 85
137 3300042611 Ga0466697_240388 Ga0466697_240388_570_827 85
138 3300042612 Ga0466705_222636 Ga0466705_222636_203_460 85
139 3300042612 Ga0466705_525713 Ga0466705_525713_665_922 85
140 3300042613 Ga0466710_038969 Ga0466710_038969_143_400 85
141 3300042613 Ga0466710_087835 Ga0466710_087835_263_520 85
142 3300042613 Ga0466710_181731 Ga0466710_181731_549_806 85
143 3300042613 Ga0466710_319466 Ga0466710_319466_747_1004 85
144 3300042615 Ga0466711_289238 Ga0466711_289238_35109_35366 85
145 3300042615 Ga0466711_464836 Ga0466711_464836_29578_29835 85
146 3300042616 Ga0466715_016723 Ga0466715_016723_1147_1404 85
147 3300042616 Ga0466715_045203 Ga0466715_045203_10734_10991 85
148 3300042616 Ga0466715_128269 Ga0466715_128269_651_908 85
149 3300042616 Ga0466715_209992 Ga0466715_209992_6643_6900 85
150 3300042616 Ga0466715_595690 Ga0466715_595690_5468_5725 85
151 3300042617 Ga0466718_062717 Ga0466718_062717_313_570 85
152 3300042617 Ga0466718_119526 Ga0466718_119526_1106_1363 85
153 3300042617 Ga0466718_146676 Ga0466718_146676_1661_1918 85
154 3300042618 Ga0466723_058528 Ga0466723_058528_18319_18576 85
155 3300042618 Ga0466723_196307 Ga0466723_196307_32_289 85
156 3300042618 Ga0466723_198099 Ga0466723_198099_1608_1865 85
157 3300042619 Ga0466726_144476 Ga0466726_144476_11025_11282 85
158 3300042619 Ga0466726_242160 Ga0466726_242160_4153_4410 85
159 3300042620 Ga0466728_294355 Ga0466728_294355_3106_3363 85
160 3300042622 Ga0466731_316999 Ga0466731_316999_510_767 85
161 3300042623 Ga0466734_063656 Ga0466734_063656_304_561 85
162 3300042623 Ga0466734_158837 Ga0466734_158837_169_426 85
163 3300042624 Ga0466735_069412 Ga0466735_069412_756_1013 85
164 3300042624 Ga0466735_152196 Ga0466735_152196_3311_3568 85
165 3300042624 Ga0466735_166733 Ga0466735_166733_65_322 85
166 3300042624 Ga0466735_174105 Ga0466735_174105_215_472 85
167 3300042624 Ga0466735_177951 Ga0466735_177951_5841_6098 85
168 3300042624 Ga0466735_180421 Ga0466735_180421_1275_1532 85
169 3300042624 Ga0466735_199067 Ga0466735_199067_2849_3106 85
170 3300042624 Ga0466735_207348 Ga0466735_207348_524_781 85
171 3300042625 Ga0466730_084715 Ga0466730_084715_424_681 85
172 3300042635 Ga0466702_138136 Ga0466702_138136_1545_1802 85
173 3300042635 Ga0466702_229598 Ga0466702_229598_814_1071 85
174 3300042636 Ga0466703_073446 Ga0466703_073446_651_908 85
175 3300042636 Ga0466703_083810 Ga0466703_083810_540_797 85
176 3300042636 Ga0466703_367008 Ga0466703_367008_22234_22491 85
177 3300042636 Ga0466703_388735 Ga0466703_388735_1256_1513 85
178 3300042643 Ga0466704_134293 Ga0466704_134293_9017_9274 85
179 3300042643 Ga0466704_541626 Ga0466704_541626_2878_3135 85
180 3300042649 Ga0466724_39918 Ga0466724_39918_750_1007 85
181 3300042649 Ga0466724_68043 Ga0466724_68043_454_711 85
182 3300042649 Ga0466724_68870 Ga0466724_68870_266_523 85
183 3300042654 Ga0466725_213877 Ga0466725_213877_862_1119 85
184 3300042654 Ga0466725_237462 Ga0466725_237462_494_751 85
185 3300042655 Ga0466727_050462 Ga0466727_050462_10394_10651 85
186 3300042659 Ga0466733_042896 Ga0466733_042896_512_769 85
187 3300042659 Ga0466733_052339 Ga0466733_052339_27434_27691 85
188 3300042659 Ga0466733_091282 Ga0466733_091282_34_291 85
189 3300042659 Ga0466733_132245 Ga0466733_132245_155_412 85
190 3300042659 Ga0466733_169758 Ga0466733_169758_166_423 85
191 3300042659 Ga0466733_177289 Ga0466733_177289_212_469 85
192 3300042659 Ga0466733_188673 Ga0466733_188673_55_312 85
193 3300056842 Ga0562377_0004 Ga0562377_0004_3472407_3472664 85
194 iso_pr_bacteria 2695420314 2695473231 85
195 iso_pr_bacteria 2695420317 2695484883 85
196 iso_pr_bacteria 2811995047 2812947427 85
197 iso_pr_bacteria 2820762746 2820764332 85
198 iso_pr_bacteria 2882250448 2882252296 85
199 iso_pr_bacteria 2894649344 2894650493 85
200 iso_pr_bacteria 2899132286 2899134773 85
201 iso_pr_bacteria 2910926975 2910930140 85
202 iso_pr_bacteria 2910942425 2910944139 85
203 iso_pr_bacteria 2910949487 2910951312 85
204 iso_pr_bacteria 2910959314 2910959529 85
205 iso_pr_bacteria 2922326829 2922327960 85
206 iso_pr_bacteria 2923982719 2923983207 85
207 iso_pr_bacteria 2940193328 2940194742 85
208 iso_pr_bacteria 2940199050 2940199571 85
209 iso_pr_bacteria 2940202316 2940204402 85
210 iso_pr_bacteria 2940209341 2940209438 85
211 iso_pr_bacteria 2940244548 2940244778 85
212 iso_pr_bacteria 2940248789 2940249018 85
213 iso_pr_bacteria 2940253009 2940253256 85
214 iso_pr_bacteria 2940257232 2940257692 85
215 iso_pr_bacteria 2940336608 2940338019 85
216 iso_pr_bacteria 2940346213 2940347100 85
217 iso_pr_bacteria 3004672520 3004672636 85
218 iso_pr_bacteria 3004677695 3004680432 85
219 iso_pr_bacteria 8100157865 8100158751 85
220 iso_pr_bacteria 8100166142 8100169610 85
221 2021593000 TM1208_contig56605 TM1208A_249760 86
222 3300000062 IMNBL1DRAFT_c0000687 IMNBL1DRAFT_000068722 86
223 3300000062 IMNBL1DRAFT_c0004898 IMNBL1DRAFT_000489813 86
224 3300000062 IMNBL1DRAFT_c0049412 IMNBL1DRAFT_00494122 86
225 3300000062 IMNBL1DRAFT_c0143729 IMNBL1DRAFT_01437292 86
226 3300002449 JGI24698J34947_10051090 JGI24698J34947_100510904 86
227 3300002462 JGI24702J35022_10000547 JGI24702J35022_1000054713 86
228 3300002462 JGI24702J35022_10000840 JGI24702J35022_1000084012 86
229 3300002462 JGI24702J35022_10002652 JGI24702J35022_100026524 86
230 3300002462 JGI24702J35022_10008763 JGI24702J35022_100087637 86
231 3300002462 JGI24702J35022_10015899 JGI24702J35022_100158993 86
232 3300002462 JGI24702J35022_10022268 JGI24702J35022_100222684 86
233 3300002462 JGI24702J35022_10023308 JGI24702J35022_100233086 86
234 3300002462 JGI24702J35022_10078783 JGI24702J35022_100787833 86
235 3300002462 JGI24702J35022_10081541 JGI24702J35022_100815411 86
236 3300002462 JGI24702J35022_10098556 JGI24702J35022_100985563 86
237 3300002462 JGI24702J35022_10427277 JGI24702J35022_104272772 86
238 3300002462 JGI24702J35022_10430787 JGI24702J35022_104307873 86
239 3300002462 JGI24702J35022_10476861 JGI24702J35022_104768612 86
240 3300002462 JGI24702J35022_10483191 JGI24702J35022_104831913 86
241 3300002504 JGI24705J35276_12054925 JGI24705J35276_120549252 86
242 3300002504 JGI24705J35276_12214984 JGI24705J35276_122149844 86
243 3300002509 JGI24699J35502_11134150 JGI24699J35502_1113415035 86
244 3300002834 JGI24696J40584_12431188 JGI24696J40584_124311881 86
245 3300002834 JGI24696J40584_12814696 JGI24696J40584_128146961 86
246 3300005071 Ga0068302_10124393 Ga0068302_101243932 86
247 3300005071 Ga0068302_10187713 Ga0068302_1018771310 86
248 3300005083 Ga0068305_10026156 Ga0068305_1002615614 86
249 3300005083 Ga0068305_10200441 Ga0068305_102004413 86
250 3300005201 Ga0072941_1219958 Ga0072941_12199584 86
251 3300005319 Ga0074304_1139657 Ga0074304_11396574 86
252 3300005721 Ga0074278_136834 Ga0074278_1368342 86
253 3300007190 Ga0103267_1000475 Ga0103267_100047513 86
254 3300009784 Ga0123357_10000330 Ga0123357_1000033024 86
255 3300009784 Ga0123357_10030639 Ga0123357_1003063913 86
256 3300009784 Ga0123357_10316724 Ga0123357_103167241 86
257 3300009784 Ga0123357_10473530 Ga0123357_104735302 86
258 3300010049 Ga0123356_10020734 Ga0123356_100207343 86
259 3300010049 Ga0123356_10073866 Ga0123356_100738664 86
260 3300010049 Ga0123356_10531087 Ga0123356_105310874 86
261 3300010049 Ga0123356_10824572 Ga0123356_108245722 86
262 3300010049 Ga0123356_11153446 Ga0123356_111534462 86
263 3300010049 Ga0123356_11703014 Ga0123356_117030142 86
264 3300010049 Ga0123356_11972080 Ga0123356_119720802 86
265 3300010049 Ga0123356_12013372 Ga0123356_120133723 86
266 3300010049 Ga0123356_13331084 Ga0123356_133310841 86
267 3300010167 Ga0123353_10076527 Ga0123353_100765273 86
268 3300010167 Ga0123353_10367522 Ga0123353_103675223 86
269 3300010167 Ga0123353_11012372 Ga0123353_110123723 86
270 3300010167 Ga0123353_11325684 Ga0123353_113256843 86
271 3300010882 Ga0123354_10000498 Ga0123354_1000049815 86
272 3300010882 Ga0123354_10001124 Ga0123354_1000112427 86
273 3300010882 Ga0123354_10335090 Ga0123354_103350904 86
274 3300010882 Ga0123354_10352651 Ga0123354_103526512 86
275 3300012845 Ga0160460_100001 Ga0160460_100001643 86
276 3300021240 Ga0223684_1051054 Ga0223684_10510542 86
277 3300022232 Ga0233288_1000587 Ga0233288_10005874 86
278 3300022820 Ga0255809_1015644 Ga0255809_10156442 86
279 3300022820 Ga0255809_1020061 Ga0255809_10200612 86
280 3300024493 Ga0264413_138535 Ga0264413_13853516 86
281 3300042590 Ga0466690_168212 Ga0466690_168212_4504_4764 86
282 3300042592 Ga0466693_078533 Ga0466693_078533_1028_1288 86
283 3300042594 Ga0466694_006142 Ga0466694_006142_94_354 86
284 3300042594 Ga0466694_170101 Ga0466694_170101_885_1145 86
285 3300042595 Ga0466695_330118 Ga0466695_330118_1716_1976 86
286 3300042608 Ga0466721_149392 Ga0466721_149392_439_699 86
287 3300042610 Ga0466698_105271 Ga0466698_105271_17217_17477 86
288 3300042610 Ga0466698_439910 Ga0466698_439910_38_298 86
289 3300042613 Ga0466710_435809 Ga0466710_435809_799_1059 86
290 3300042622 Ga0466731_370304 Ga0466731_370304_32_292 86
291 3300042635 Ga0466702_406892 Ga0466702_406892_233_493 86
292 3300042654 Ga0466725_255972 Ga0466725_255972_11555_11815 86
293 3300042656 Ga0466732_141961 Ga0466732_141961_2673_2933 86
294 3300042659 Ga0466733_220977 Ga0466733_220977_12670_12930 86
295 iso_pr_bacteria 2778260940 2778356200 86
296 iso_pr_bacteria 2864878056 2864881679 86
297 iso_pr_bacteria 2864886855 2864890683 86
298 2225789004 2227256381 2227701227 87
299 3300000062 IMNBL1DRAFT_c0022374 IMNBL1DRAFT_00223742 87
300 3300002449 JGI24698J34947_10000555 JGI24698J34947_1000055510 87
301 3300002449 JGI24698J34947_10043085 JGI24698J34947_100430853 87
302 3300002834 JGI24696J40584_12858116 JGI24696J40584_128581163 87
303 3300007149 Ga0104040_1000171 Ga0104040_10001715 87
304 3300010049 Ga0123356_10020898 Ga0123356_100208984 87
305 3300010049 Ga0123356_10441924 Ga0123356_104419244 87
306 3300010167 Ga0123353_10392289 Ga0123353_103922893 87
307 3300012848 Ga0160443_100370 Ga0160443_1003704 87
308 3300024493 Ga0264413_160170 Ga0264413_1601704 87
309 3300042590 Ga0466690_147457 Ga0466690_147457_10341_10604 87
310 3300042596 Ga0466696_247964 Ga0466696_247964_309_572 87
311 3300042596 Ga0466696_466695 Ga0466696_466695_673_936 87
312 3300042601 Ga0466707_315151 Ga0466707_315151_6169_6432 87
313 3300042610 Ga0466698_113235 Ga0466698_113235_1130_1393 87
314 3300042615 Ga0466711_103283 Ga0466711_103283_224_487 87
315 3300042618 Ga0466723_027283 Ga0466723_027283_5087_5350 87
316 3300042621 Ga0466729_114753 Ga0466729_114753_2494_2757 87
317 3300042621 Ga0466729_117205 Ga0466729_117205_20208_20471 87
318 3300042621 Ga0466729_226506 Ga0466729_226506_210_473 87
319 3300042624 Ga0466735_014487 Ga0466735_014487_5470_5733 87
320 3300042624 Ga0466735_017392 Ga0466735_017392_1442_1705 87
321 3300042624 Ga0466735_164481 Ga0466735_164481_1109_1372 87
322 3300042624 Ga0466735_172430 Ga0466735_172430_8917_9180 87
323 3300042624 Ga0466735_221794 Ga0466735_221794_336_599 87
324 3300042659 Ga0466733_062198 Ga0466733_062198_734_997 87
325 3300042659 Ga0466733_122413 Ga0466733_122413_15441_15704 87
326 iso_pr_bacteria 2820741847 2820742463 87
327 iso_pr_bacteria 2864836148 2864836273 87
328 iso_pr_bacteria 8065497608 8065499074 87
329 3300000062 IMNBL1DRAFT_c0001224 IMNBL1DRAFT_00012244 88
330 3300005083 Ga0068305_10001103 Ga0068305_1000110310 88
331 3300007505 Ga0105005_1046106 Ga0105005_10461063 88
332 3300010049 Ga0123356_10069677 Ga0123356_100696772 88
333 3300010049 Ga0123356_10115768 Ga0123356_101157687 88
334 3300010167 Ga0123353_10000124 Ga0123353_1000012434 88
335 3300010167 Ga0123353_10609944 Ga0123353_106099443 88
336 3300010167 Ga0123353_11666204 Ga0123353_116662042 88
337 3300042590 Ga0466690_136616 Ga0466690_136616_20514_20780 88
338 3300042596 Ga0466696_466060 Ga0466696_466060_429_695 88
339 3300042602 Ga0466713_027800 Ga0466713_027800_13852_14118 88
340 3300042609 Ga0466722_073972 Ga0466722_073972_23300_23566 88
341 3300042616 Ga0466715_025469 Ga0466715_025469_9151_9417 88
342 3300042616 Ga0466715_233174 Ga0466715_233174_306_572 88
343 3300042636 Ga0466703_109702 Ga0466703_109702_8379_8645 88
344 3300042643 Ga0466704_051937 Ga0466704_051937_525_791 88
345 3300042643 Ga0466704_477103 Ga0466704_477103_6868_7134 88
346 iso_pr_bacteria 2645727721 2646684817 88
347 iso_pr_bacteria 2684622911 2686074176 88
348 iso_pr_bacteria 2684622912 2686075893 88
349 iso_pr_bacteria 2684622913 2686077778 88
350 iso_pr_bacteria 2684622914 2686079609 88
351 iso_pr_bacteria 2758568501 2760245768 88
352 iso_pr_bacteria 2758568502 2760247401 88
353 iso_pr_bacteria 2758568503 2760249063 88
354 iso_pr_bacteria 2758568504 2760250725 88
355 iso_pr_bacteria 2758568505 2760252353 88
356 iso_pr_bacteria 2758568506 2760254125 88
357 iso_pr_bacteria 2758568507 2760255654 88
358 iso_pr_bacteria 2758568508 2760257353 88
359 iso_pr_bacteria 2758568509 2760259053 88
360 iso_pr_bacteria 2758568510 2760260874 88
361 iso_pr_bacteria 2758568511 2760262528 88
362 iso_pr_bacteria 2758568512 2760264281 88
363 iso_pr_bacteria 2758568513 2760266127 88
364 iso_pr_bacteria 2758568514 2760268135 88
365 iso_pr_bacteria 2758568515 2760269972 88
366 iso_pr_bacteria 2758568558 2760424210 88
367 iso_pr_bacteria 2785510748 2785747781 88
368 iso_pr_bacteria 2799112220 2799192063 88
369 iso_pr_bacteria 2799112229 2799230127 88
370 iso_pr_bacteria 2799112230 2799232108 88
371 iso_pr_bacteria 2814123166 2815023101 88
372 iso_pr_bacteria 2851410423 2851411795 88
373 iso_pr_bacteria 2877513988 2877515445 88
374 iso_pr_bacteria 2882334426 2882335416 88
375 iso_pr_bacteria 2912324399 2912325639 88
376 iso_pr_bacteria 2940371297 2940373364 88
377 iso_pr_bacteria 2958885890 2958887125 88
378 iso_pr_bacteria 2961465228 2961466582 88
379 iso_pr_bacteria 2961515617 2961516946 88
380 iso_pr_bacteria 2968368220 2968369790 88
381 iso_pr_bacteria 2971062614 2971063700 88
382 iso_pr_bacteria 2979949929 2979951279 88
383 iso_pr_bacteria 3004719924 3004721810 88
384 iso_pr_bacteria 8004832522 8004833748 88
385 iso_pr_bacteria 8017440191 8017440807 88
386 iso_pr_bacteria 8017462664 8017464218 88
387 iso_pr_bacteria 8017536074 8017537611 88
388 3300000062 IMNBL1DRAFT_c0058981 IMNBL1DRAFT_00589814 89
389 3300002462 JGI24702J35022_10807958 JGI24702J35022_108079582 89
390 3300042593 Ga0466691_204814 Ga0466691_204814_12676_12945 89
391 3300042616 Ga0466715_154449 Ga0466715_154449_10883_11152 89
392 3300042624 Ga0466735_027088 Ga0466735_027088_312_581 89
393 3300042648 Ga0466709_083357 Ga0466709_083357_18220_18489 89
394 3300042655 Ga0466727_230520 Ga0466727_230520_121_390 89
395 iso_pr_bacteria 2820873081 2820873467 89
396 3300010167 Ga0123353_10870821 Ga0123353_108708213 91
397 3300042613 Ga0466710_153421 Ga0466710_153421_1315_1590 91
398 3300007190 Ga0103267_1000167 Ga0103267_100016717 96
399 3300042607 Ga0466720_033681 Ga0466720_033681_460_768 102

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00366 Ribosomal_S17 Ribosomal protein S17 29 96 0.99

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.