Protein Family IF06606

Metagenome Isolate
163 Members
45 Samples
159 Scaffolds
273.23 Avg Length

🧬 Representative Sequence

ID
3300042607|Ga0466720_008940|Ga0466720_008940_940_1899
Length
319 aa
Sequence
MGNQSIKKAKKTKMNIGKQKKGKIRKKRKNMLYYAIFKEANMLKPEQKKELARKALQLRYDVLEMIGVGIAGHLGGSSSLAELIAVLYCNKMNFSADRLNDPNRDRLVISKGHAALIQYAGLCEKGCFPREELKRVKTLHGLLQGHPDCSIPGIEAVTGSLGQGLSVAVGMALALRLDKSPARVYAIMGDGEQSEGQIWEAAMAAANFKVGNLTAFIDWNKVQATGATKDIFNIPDLDKKWAAFGWNVANADGHDFEKIIEAIEKAEAVKDRPSVIILDTVKGKCFSFAEGNPAYHNGIFTEEVYQKAIRELDTIKAGI

📊 Sample Types

Isolate 2.5%
Metagenome 97.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 31.1%
Unclassified 15.6%
Rhinotermitidae 8.9%
Termopsidae 8.9%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 152
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
31 650716102 Treponema primitia ZAS-2 Isolate Unclassified
32 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
42 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
45 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_005355 3300042612 Bacteria 12648
2 Ga0466732_222708 3300042656 Bacteria 1651
3 JGI24702J35022_10125911 3300002462 Bacteria 1418
4 Ga0466729_200749 3300042621 Bacteria 1283
5 Ga0466702_229137 3300042635 Bacteria 1518
6 Ga0466703_164185 3300042636 Bacteria 13810
7 Ga0466704_153012 3300042643 Bacteria 54848
8 Ga0466709_069036 3300042648 Bacteria 8334
9 Ga0466705_530910 3300042612 Bacteria 6628
10 Ga0466711_171365 3300042615 Bacteria 2875
11 Ga0466711_452483 3300042615 Bacteria 4287
12 Ga0466715_137354 3300042616 Bacteria 4184
13 Ga0466715_571000 3300042616 Bacteria 3453
14 Ga0466726_045482 3300042619 Bacteria 10065
15 Ga0466726_386545 3300042619 Bacteria 1265
16 Ga0466728_036752 3300042620 Bacteria 3982
17 Ga0466692_130004 3300042591 Bacteria 2478
18 Ga0466692_173774 3300042591 Bacteria 1261
19 Ga0466693_342795 3300042592 Bacteria 3048
20 Ga0466691_180980 3300042593 Bacteria 11427
21 Ga0466696_299528 3300042596 Bacteria 7410
22 Ga0466699_001477 3300042597 Bacteria 12521
23 Ga0466705_064390 3300042612 Unclassified 7668
24 Ga0466705_257629 3300042612 Bacteria 1281
25 Ga0123357_10169704 3300009784 Bacteria 2585
26 Ga0466703_099574 3300042636 Bacteria 4543
27 Ga0466703_296916 3300042636 Bacteria 11746
28 Ga0466703_343799 3300042636 Bacteria 7809
29 Ga0466704_439785 3300042643 Bacteria 8544
30 Ga0466709_406816 3300042648 Bacteria 10177
31 Ga0466727_195003 3300042655 Bacteria 6162
32 Ga0466711_198332 3300042615 Bacteria 11847
33 Ga0466711_214922 3300042615 Bacteria 11553
34 Ga0466718_120508 3300042617 Archaea 2299
35 Ga0466728_295881 3300042620 Bacteria 18247
36 Ga0466729_178881 3300042621 Bacteria 2917
37 Ga0466690_235809 3300042590 Bacteria 3587
38 Ga0466692_139567 3300042591 Bacteria 2121
39 Ga0466694_119610 3300042594 Bacteria 2649
40 Ga0466707_242621 3300042601 Bacteria 1438
41 Ga0466707_395539 3300042601 Bacteria 2958
42 Ga0466719_117290 3300042606 Unclassified 3980
43 Ga0466720_010760 3300042607 Bacteria 4241
44 Ga0466705_251496 3300042612 Bacteria 7979
45 Ga0068305_10151349 3300005083 Bacteria 2675
46 Ga0466729_309233 3300042621 Bacteria 3470
47 Ga0466735_086209 3300042624 Bacteria 1065
48 Ga0466735_231477 3300042624 Bacteria 2111
49 Ga0466704_036882 3300042643 Bacteria 35525
50 Ga0466704_086535 3300042643 Bacteria 19417
51 Ga0466704_157909 3300042643 Bacteria 8145
52 Ga0466709_366779 3300042648 Bacteria 13254
53 Ga0466708_025646 3300042652 Bacteria 3218
54 Ga0466708_311325 3300042652 Bacteria 25902
55 Ga0466708_402532 3300042652 Bacteria 1414
56 Ga0466705_457316 3300042612 Bacteria 5278
57 Ga0466711_262896 3300042615 Bacteria 2842
58 Ga0466711_314808 3300042615 Unclassified 2023
59 Ga0466723_107839 3300042618 Bacteria 2178
60 Ga0466726_231897 3300042619 Unclassified 1494
61 Ga0466690_035799 3300042590 Bacteria 6539
62 Ga0466692_083543 3300042591 Bacteria 3769
63 Ga0466691_010727 3300042593 Bacteria 21088
64 Ga0466694_031927 3300042594 Bacteria 3476
65 Ga0466699_106766 3300042597 Bacteria 5679
66 Ga0466707_283011 3300042601 Bacteria 1182
67 Ga0466720_089322 3300042607 Unclassified 3174
68 Ga0466722_174138 3300042609 Bacteria 6431
69 Ga0466722_206200 3300042609 Bacteria 5294
70 Ga0466705_324741 3300042612 Bacteria 3382
71 Ga0466712_130658 3300042614 Bacteria 3935
72 Ga0466726_186339 3300042619 Bacteria 2700
73 Ga0456237_0003520 3300041968 Bacteria 2532
74 Ga0466691_073234 3300042593 Bacteria 9834
75 Ga0466696_372044 3300042596 Bacteria 9546
76 Ga0466707_206106 3300042601 Bacteria 3562
77 Ga0466719_220208 3300042606 Bacteria 2056
78 Ga0466720_010868 3300042607 Bacteria 1114
79 Ga0466722_052050 3300042609 Bacteria 3667
80 Ga0466722_071808 3300042609 Bacteria 3244
81 Ga0466722_188308 3300042609 Bacteria 1553
82 Ga0466705_168059 3300042612 Bacteria 4398
83 JGI24695J34938_10045018 3300002450 Unclassified 1959
84 JGI24695J34938_10075949 3300002450 Bacteria 1395
85 JGI24702J35022_10004731 3300002462 Bacteria 8053
86 Ga0068302_10037561 3300005071 Unclassified 2927
87 Ga0466703_065065 3300042636 Bacteria 10516
88 Ga0466704_337004 3300042643 Bacteria 4436
89 Ga0466708_109624 3300042652 Bacteria 3582
90 Ga0466708_289104 3300042652 Bacteria 6140
91 Ga0466727_038125 3300042655 Bacteria 1968
92 Ga0466727_282364 3300042655 Bacteria 10266
93 Ga0466711_000085 3300042615 Bacteria 3677
94 Ga0466726_187383 3300042619 Bacteria 19163
95 Ga0466726_315165 3300042619 Bacteria 2519
96 Ga0466728_258466 3300042620 Bacteria 7285
97 Ga0456237_0002485 3300041968 Unclassified 2979
98 Ga0466692_015405 3300042591 Bacteria 1811
99 Ga0466691_055336 3300042593 Bacteria 3245
100 Ga0466694_002093 3300042594 Bacteria 57040
101 Ga0466694_377099 3300042594 Bacteria 1152
102 Ga0466696_069891 3300042596 Unclassified 2191
103 Ga0466716_125583 3300042605 Bacteria 4697
104 Ga0466716_378245 3300042605 Bacteria 4629
105 Ga0466719_000505 3300042606 Bacteria 7900
106 Ga0466720_008940 3300042607 Bacteria 2507
107 Ga0466705_107762 3300042612 Bacteria 7757
108 Ga0466703_085219 3300042636 Bacteria 6465
109 Ga0466703_207668 3300042636 Bacteria 20271
110 Ga0466723_061965 3300042618 Bacteria 1634
111 Ga0466726_058357 3300042619 Bacteria 6981
112 Ga0466726_188860 3300042619 Bacteria 5521
113 Ga0466729_120574 3300042621 Bacteria 1879
114 Ga0466690_049581 3300042590 Bacteria 3843
115 Ga0466690_059042 3300042590 Bacteria 1363
116 Ga0466707_046573 3300042601 Bacteria 1028
117 Ga0466719_418419 3300042606 Bacteria 1769
118 Ga0466720_151858 3300042607 Bacteria 1856
119 Ga0466722_033931 3300042609 Bacteria 12800
120 Ga0466722_063984 3300042609 Bacteria 16598
121 Ga0466698_021445 3300042610 Bacteria 1759
122 Ga0466698_149873 3300042610 Bacteria 2090
123 AustNasuHG_c1006323 3300000089 Bacteria 4233
124 JGI24698J34947_10000869 3300002449 Bacteria 15238
125 Ga0466704_031441 3300042643 Bacteria 1128
126 Ga0466704_072274 3300042643 Bacteria 12914
127 Ga0466704_166593 3300042643 Bacteria 11993
128 Ga0466709_257456 3300042648 Bacteria 4568
129 Ga0466709_392427 3300042648 Bacteria 5812
130 Ga0466727_138468 3300042655 Bacteria 1659
131 Ga0466727_241613 3300042655 Bacteria 2905
132 Ga0466727_284361 3300042655 Bacteria 3022
133 Ga0466711_227825 3300042615 Bacteria 191336
134 Ga0466715_008577 3300042616 Bacteria 1617
135 Ga0466723_019563 3300042618 Bacteria 12902
136 Ga0466726_427508 3300042619 Bacteria 2200
137 Ga0466692_116614 3300042591 Bacteria 8358
138 Ga0466694_400486 3300042594 Bacteria 2575
139 Ga0466696_054381 3300042596 Bacteria 22881
140 Ga0466706_158509 3300042599 Bacteria 5049
141 Ga0466707_086326 3300042601 Unclassified 1585
142 Ga0466707_208725 3300042601 Bacteria 1144
143 Ga0466713_094670 3300042602 Bacteria 1987
144 Ga0466720_028434 3300042607 Bacteria 9245
145 Ga0466720_033395 3300042607 Bacteria 3213
146 Ga0466722_094174 3300042609 Bacteria 17191
147 Ga0466732_101831 3300042656 Bacteria 9208
148 JGI24702J35022_10017679 3300002462 Bacteria 3894
149 Ga0123356_10018919 3300010049 Bacteria 6534
150 Ga0466709_234894 3300042648 Bacteria 6765
151 Ga0466727_105768 3300042655 Bacteria 1022
152 Ga0466727_294397 3300042655 Bacteria 2588
153 Ga0466711_402336 3300042615 Bacteria 2292
154 Ga0466715_200459 3300042616 Bacteria 3189
155 Ga0466723_278823 3300042618 Bacteria 14067
156 Ga0466692_055865 3300042591 Bacteria 1528
157 Ga0466719_260578 3300042606 Bacteria 9429
158 Ga0466722_050101 3300042609 Bacteria 1886
159 Ga0466722_188102 3300042609 Bacteria 10181

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_138468 Ga0466727_138468_927_1637 219
2 3300042601 Ga0466707_283011 Ga0466707_283011_410_1132 225
3 3300042593 Ga0466691_180980 Ga0466691_180980_6438_7277 248
4 3300042636 Ga0466703_296916 Ga0466703_296916_1613_2452 248
5 3300042615 Ga0466711_314808 Ga0466711_314808_14_955 254
6 3300042621 Ga0466729_309233 Ga0466729_309233_2641_3429 257
7 3300002462 JGI24702J35022_10004731 JGI24702J35022_100047314 259
8 3300042615 Ga0466711_171365 Ga0466711_171365_1337_2161 259
9 3300042620 Ga0466728_258466 Ga0466728_258466_5705_6541 259
10 3300042636 Ga0466703_085219 Ga0466703_085219_3511_4347 259
11 3300042607 Ga0466720_010760 Ga0466720_010760_1982_2818 262
12 3300042606 Ga0466719_220208 Ga0466719_220208_1083_1919 263
13 3300042624 Ga0466735_086209 Ga0466735_086209_53_889 263
14 3300042612 Ga0466705_324741 Ga0466705_324741_2285_3121 264
15 3300042619 Ga0466726_315165 Ga0466726_315165_971_1807 264
16 3300042643 Ga0466704_157909 Ga0466704_157909_7219_8055 264
17 3300042643 Ga0466704_439785 Ga0466704_439785_4320_5156 264
18 3300042655 Ga0466727_038125 Ga0466727_038125_1081_1917 264
19 3300002449 JGI24698J34947_10000869 JGI24698J34947_1000086912 265
20 3300002462 JGI24702J35022_10125911 JGI24702J35022_101259111 266
21 3300042596 Ga0466696_372044 Ga0466696_372044_7164_8003 266
22 3300042601 Ga0466707_395539 Ga0466707_395539_12_866 266
23 3300042606 Ga0466719_260578 Ga0466719_260578_5508_6368 266
24 3300042643 Ga0466704_072274 Ga0466704_072274_5902_6762 266
25 3300042601 Ga0466707_242621 Ga0466707_242621_423_1259 267
26 3300042612 Ga0466705_457316 Ga0466705_457316_3341_4177 267
27 3300042615 Ga0466711_452483 Ga0466711_452483_2570_3406 267
28 3300042621 Ga0466729_200749 Ga0466729_200749_394_1230 267
29 3300042593 Ga0466691_010727 Ga0466691_010727_14571_15404 268
30 3300042593 Ga0466691_055336 Ga0466691_055336_1693_2529 268
31 3300042593 Ga0466691_073234 Ga0466691_073234_5949_6785 268
32 3300042594 Ga0466694_377099 Ga0466694_377099_280_1116 268
33 3300042594 Ga0466694_400486 Ga0466694_400486_1031_1897 268
34 3300042606 Ga0466719_000505 Ga0466719_000505_111_947 268
35 3300042609 Ga0466722_033931 Ga0466722_033931_1388_2224 268
36 3300042616 Ga0466715_137354 Ga0466715_137354_2129_2965 268
37 3300042616 Ga0466715_571000 Ga0466715_571000_2226_3062 268
38 3300042618 Ga0466723_061965 Ga0466723_061965_787_1623 268
39 3300042635 Ga0466702_229137 Ga0466702_229137_12_848 268
40 3300042643 Ga0466704_337004 Ga0466704_337004_2470_3306 268
41 3300042648 Ga0466709_257456 Ga0466709_257456_1772_2608 268
42 3300042648 Ga0466709_392427 Ga0466709_392427_1803_2639 268
43 3300042652 Ga0466708_025646 Ga0466708_025646_1280_2125 268
44 3300042652 Ga0466708_109624 Ga0466708_109624_74_910 268
45 3300042655 Ga0466727_195003 Ga0466727_195003_3210_4046 268
46 3300042655 Ga0466727_241613 Ga0466727_241613_300_1136 268
47 3300042655 Ga0466727_294397 Ga0466727_294397_439_1275 268
48 3300041968 Ga0456237_0002485 Ga0456237_0002485_328_1167 269
49 3300042591 Ga0466692_116614 Ga0466692_116614_3902_4741 269
50 3300042591 Ga0466692_130004 Ga0466692_130004_109_948 269
51 3300042601 Ga0466707_206106 Ga0466707_206106_693_1529 269
52 3300042609 Ga0466722_063984 Ga0466722_063984_2888_3727 269
53 3300042612 Ga0466705_257629 Ga0466705_257629_215_1051 269
54 3300042615 Ga0466711_227825 Ga0466711_227825_22019_22855 269
55 3300042619 Ga0466726_058357 Ga0466726_058357_664_1503 269
56 3300042655 Ga0466727_282364 Ga0466727_282364_1753_2613 269
57 3300042590 Ga0466690_035799 Ga0466690_035799_4098_4934 270
58 3300042605 Ga0466716_378245 Ga0466716_378245_3123_3959 270
59 3300042612 Ga0466705_107762 Ga0466705_107762_6026_6862 270
60 3300042612 Ga0466705_251496 Ga0466705_251496_2901_3737 270
61 3300042618 Ga0466723_019563 Ga0466723_019563_4959_5795 270
62 3300042619 Ga0466726_187383 Ga0466726_187383_13422_14258 270
63 3300042648 Ga0466709_366779 Ga0466709_366779_7704_8540 270
64 3300042606 Ga0466719_117290 Ga0466719_117290_1006_2001 271
65 3300042616 Ga0466715_200459 Ga0466715_200459_834_1904 271
66 3300042597 Ga0466699_001477 Ga0466699_001477_4066_4902 272
67 3300042599 Ga0466706_158509 Ga0466706_158509_1670_2512 272
68 3300042609 Ga0466722_050101 Ga0466722_050101_48_1070 272
69 3300042612 Ga0466705_064390 Ga0466705_064390_4224_5276 272
70 3300042615 Ga0466711_198332 Ga0466711_198332_3487_4509 272
71 3300042616 Ga0466715_008577 Ga0466715_008577_485_1321 272
72 3300042619 Ga0466726_231897 Ga0466726_231897_498_1337 272
73 3300042594 Ga0466694_002093 Ga0466694_002093_30515_31351 273
74 3300042615 Ga0466711_214922 Ga0466711_214922_890_1726 273
75 3300042618 Ga0466723_107839 Ga0466723_107839_368_1204 273
76 3300042619 Ga0466726_186339 Ga0466726_186339_849_1685 273
77 3300042636 Ga0466703_207668 Ga0466703_207668_10614_11477 273
78 3300042648 Ga0466709_234894 Ga0466709_234894_116_1141 273
79 3300042655 Ga0466727_284361 Ga0466727_284361_1962_2798 273
80 3300002450 JGI24695J34938_10045018 JGI24695J34938_100450182 274
81 3300042656 Ga0466732_222708 Ga0466732_222708_131_982 274
82 3300042601 Ga0466707_046573 Ga0466707_046573_40_909 275
83 3300042606 Ga0466719_418419 Ga0466719_418419_759_1610 275
84 3300042610 Ga0466698_149873 Ga0466698_149873_505_1380 275
85 3300009784 Ga0123357_10169704 Ga0123357_101697042 276
86 3300042652 Ga0466708_402532 Ga0466708_402532_497_1369 276
87 3300042591 Ga0466692_055865 Ga0466692_055865_239_1072 277
88 3300042592 Ga0466693_342795 Ga0466693_342795_1763_2596 277
89 3300042607 Ga0466720_151858 Ga0466720_151858_323_1156 277
90 3300042609 Ga0466722_052050 Ga0466722_052050_2047_2880 277
91 3300042612 Ga0466705_168059 Ga0466705_168059_2223_3083 277
92 3300042618 Ga0466723_278823 Ga0466723_278823_11783_12655 277
93 3300010049 Ga0123356_10018919 Ga0123356_100189193 278
94 3300041968 Ga0456237_0003520 Ga0456237_0003520_213_1049 278
95 3300042590 Ga0466690_049581 Ga0466690_049581_1469_2305 278
96 3300042590 Ga0466690_059042 Ga0466690_059042_335_1171 278
97 3300042590 Ga0466690_235809 Ga0466690_235809_1882_2718 278
98 3300042591 Ga0466692_015405 Ga0466692_015405_216_1052 278
99 3300042591 Ga0466692_083543 Ga0466692_083543_2104_2940 278
100 3300042591 Ga0466692_173774 Ga0466692_173774_183_1019 278
101 3300042594 Ga0466694_031927 Ga0466694_031927_2521_3357 278
102 3300042594 Ga0466694_119610 Ga0466694_119610_799_1635 278
103 3300042596 Ga0466696_054381 Ga0466696_054381_18598_19434 278
104 3300042596 Ga0466696_069891 Ga0466696_069891_592_1428 278
105 3300042596 Ga0466696_299528 Ga0466696_299528_4331_5167 278
106 3300042597 Ga0466699_106766 Ga0466699_106766_1601_2437 278
107 3300042601 Ga0466707_086326 Ga0466707_086326_590_1426 278
108 3300042601 Ga0466707_208725 Ga0466707_208725_128_964 278
109 3300042605 Ga0466716_125583 Ga0466716_125583_3659_4495 278
110 3300042607 Ga0466720_010868 Ga0466720_010868_94_930 278
111 3300042607 Ga0466720_028434 Ga0466720_028434_1553_2389 278
112 3300042607 Ga0466720_033395 Ga0466720_033395_572_1408 278
113 3300042607 Ga0466720_089322 Ga0466720_089322_572_1408 278
114 3300042609 Ga0466722_188102 Ga0466722_188102_3436_4272 278
115 3300042609 Ga0466722_188308 Ga0466722_188308_146_982 278
116 3300042609 Ga0466722_206200 Ga0466722_206200_130_966 278
117 3300042610 Ga0466698_021445 Ga0466698_021445_706_1542 278
118 3300042612 Ga0466705_530910 Ga0466705_530910_285_1121 278
119 3300042614 Ga0466712_130658 Ga0466712_130658_1457_2293 278
120 3300042615 Ga0466711_402336 Ga0466711_402336_1345_2181 278
121 3300042617 Ga0466718_120508 Ga0466718_120508_283_1119 278
122 3300042619 Ga0466726_045482 Ga0466726_045482_314_1150 278
123 3300042619 Ga0466726_427508 Ga0466726_427508_242_1078 278
124 3300042620 Ga0466728_036752 Ga0466728_036752_841_1677 278
125 3300042620 Ga0466728_295881 Ga0466728_295881_6321_7172 278
126 3300042621 Ga0466729_120574 Ga0466729_120574_940_1776 278
127 3300042621 Ga0466729_178881 Ga0466729_178881_1932_2768 278
128 3300042636 Ga0466703_099574 Ga0466703_099574_357_1193 278
129 3300042636 Ga0466703_164185 Ga0466703_164185_7720_8556 278
130 3300042636 Ga0466703_343799 Ga0466703_343799_1974_2810 278
131 3300042643 Ga0466704_031441 Ga0466704_031441_202_1038 278
132 3300042648 Ga0466709_406816 Ga0466709_406816_6250_7086 278
133 3300042652 Ga0466708_311325 Ga0466708_311325_19367_20203 278
134 3300042656 Ga0466732_101831 Ga0466732_101831_2552_3388 278
135 iso_pr_bacteria 2781125681 2781407716 278
136 iso_pr_bacteria 2781125696 2781441480 278
137 iso_pr_bacteria 2819994798 2819997604 278
138 iso_pr_bacteria 650716102 650883361 278
139 3300000089 AustNasuHG_c1006323 AustNasuHG_10063235 279
140 3300002462 JGI24702J35022_10017679 JGI24702J35022_100176793 279
141 3300042591 Ga0466692_139567 Ga0466692_139567_31_870 279
142 3300042619 Ga0466726_188860 Ga0466726_188860_3007_3846 279
143 3300042619 Ga0466726_386545 Ga0466726_386545_298_1137 279
144 3300042643 Ga0466704_036882 Ga0466704_036882_27592_28455 279
145 3300005071 Ga0068302_10037561 Ga0068302_100375612 280
146 3300042609 Ga0466722_071808 Ga0466722_071808_1075_1917 280
147 3300042609 Ga0466722_094174 Ga0466722_094174_2853_3695 280
148 3300042609 Ga0466722_174138 Ga0466722_174138_2540_3382 280
149 3300042636 Ga0466703_065065 Ga0466703_065065_1182_2024 280
150 3300042643 Ga0466704_153012 Ga0466704_153012_41871_42713 280
151 3300042615 Ga0466711_262896 Ga0466711_262896_1003_1848 281
152 3300042643 Ga0466704_086535 Ga0466704_086535_7864_8886 281
153 3300002450 JGI24695J34938_10075949 JGI24695J34938_100759491 282
154 3300005083 Ga0068305_10151349 Ga0068305_101513493 283
155 3300042624 Ga0466735_231477 Ga0466735_231477_200_1051 283
156 3300042612 Ga0466705_005355 Ga0466705_005355_7803_8684 285
157 3300042648 Ga0466709_069036 Ga0466709_069036_935_1954 285
158 3300042655 Ga0466727_105768 Ga0466727_105768_125_982 285
159 3300042615 Ga0466711_000085 Ga0466711_000085_1766_2626 286
160 3300042643 Ga0466704_166593 Ga0466704_166593_1002_1883 293
161 3300042602 Ga0466713_094670 Ga0466713_094670_848_1780 310
162 3300042652 Ga0466708_289104 Ga0466708_289104_4155_5249 316
163 3300042607 Ga0466720_008940 Ga0466720_008940_940_1899 319

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00456 Transketolase_N Transketolase, thiamine diphosphate binding domain 62 299 0.9
PF00676 E1_dh Dehydrogenase E1 component 158 268 0.89
PF13292 DXP_synthase_N 1-deoxy-D-xylulose-5-phosphate synthase 40 208 0.79
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 156 276 0.71

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00676 GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.