Protein Family IF06566

Metagenome Isolate
151 Members
77 Samples
130 Scaffolds
237.79 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_356811|Ga0466719_356811_18466_19404
Length
276 aa
Sequence
MAKQKVIIELKRLTKRYGYGANEYYALRDFDLTVRQGEFIMIMGPSGCGKTTLLNMIGMLDAPTSGEYLLNGKPVAKMSGRRKARLRSREIGFIFQGFNLINNLPVIENVALPLVYSGYSVGRRLRMASDVLANFHLERREYYMPSQLSGGQQQRVAIARSLVAGPSIILADEPTGNLDSRTSHIVMEELSDIHAAGNTIIMVTHNPALLSHATRVINMLDGQIDTDEKMVADHDLPSPNDPEKVAVRLGAKRPLGPPVVEPVEVKTKPAAGGKKK

📊 Sample Types

Isolate 13.9%
Metagenome 86.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.8%
Unclassified 24.7%
Kalotermitidae 15.1%
Culicidae 9.6%
Armadillidiidae 8.2%
Rhinotermitidae 2.7%
Passalidae 2.7%
Elmidae 1.4%
Hydrophilidae 1.4%
Hodotermitidae 1.4%
Termopsidae 1.4%
Drosophilidae 1.4%
Cerambycidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864755708 Massilia timonae S00006 Isolate Elmidae
2 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
9 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
10 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
11 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
20 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
21 2820021908 Unclassified Spirochaetes Lab288P4bin6 Isolate Unclassified
22 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
27 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
37 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
38 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
39 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
40 642555127 Elusimicrobium minutum Pei191 Isolate Unclassified
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
43 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
44 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
45 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
46 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
47 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
48 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
49 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
50 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
51 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
52 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
53 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
54 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
55 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
56 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
57 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
58 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
59 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
60 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
61 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
62 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
63 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
64 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
65 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
66 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
67 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
68 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
69 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
70 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
71 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
72 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
73 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
74 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
75 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
76 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
77 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_324574 3300042612 Unclassified 2417
2 Ga0466733_071974 3300042659 Bacteria 4873
3 Ga0123356_10002553 3300010049 Bacteria 19449
4 Ga0123353_10000072 3300010167 Bacteria 110004
5 Ga0123353_10000210 3300010167 Bacteria 74209
6 Ga0123353_10400987 3300010167 Bacteria 2041
7 Ga0466706_131602 3300042599 Unclassified 1242
8 Ga0466714_082025 3300042603 Bacteria 2651
9 Ga0466729_252457 3300042621 Bacteria 3789
10 Ga0466724_15911 3300042649 Unclassified 15041
11 Ga0160469_100016 3300012824 Bacteria 368306
12 Ga0160433_100648 3300012846 Bacteria 13907
13 Ga0466657_064791 3300042582 Bacteria 17464
14 Ga0466715_184305 3300042616 Bacteria 16215
15 Ga0466723_069866 3300042618 Bacteria 4171
16 2227671816 2225789004 Bacteria 10201
17 Ga0072941_1049497 3300005201 Bacteria 4299
18 Ga0105005_1280275 3300007505 Bacteria 2072
19 Ga0466733_084045 3300042659 Bacteria 2580
20 Ga0123355_10028795 3300009826 Bacteria 8984
21 Ga0123353_10370409 3300010167 Bacteria 2148
22 Ga0123353_10635531 3300010167 Bacteria 1515
23 Ga0466703_422853 3300042636 Bacteria 4297
24 Ga0160468_100612 3300012819 Bacteria 13272
25 Ga0160456_100030 3300012820 Bacteria 236930
26 Ga0160455_100080 3300012837 Bacteria 157559
27 Ga0160460_100170 3300012845 Bacteria 72263
28 Ga0415639_001497 3300038395 Bacteria 101208
29 Ga0466718_016583 3300042617 Bacteria 4910
30 Ga0466726_367050 3300042619 Bacteria 6775
31 Ga0466728_226061 3300042620 Bacteria 17392
32 Ga0123356_10001976 3300010049 Unclassified 22176
33 Ga0123353_10635613 3300010167 Unclassified 1515
34 Ga0466700_097737 3300042600 Bacteria 42889
35 Ga0466707_139759 3300042601 Bacteria 6240
36 Ga0466714_014223 3300042603 Unclassified 5011
37 Ga0466719_187149 3300042606 Bacteria 13361
38 Ga0466719_513919 3300042606 Bacteria 1628
39 Ga0466704_173547 3300042643 Unclassified 4706
40 Ga0466704_537415 3300042643 Bacteria 9152
41 Ga0160460_100119 3300012845 Unclassified 100006
42 Ga0415639_002710 3300038395 Bacteria 112871
43 AglaG_contig14211 2084038013 Bacteria 1560
44 Ga0466705_221965 3300042612 Unclassified 18507
45 Ga0123355_10140569 3300009826 Bacteria 3695
46 Ga0123355_10374968 3300009826 Bacteria 1860
47 Ga0123353_10521781 3300010167 Bacteria 1723
48 Ga0123353_10557922 3300010167 Bacteria 1650
49 Ga0466706_191400 3300042599 Bacteria 38914
50 Ga0466704_336982 3300042643 Bacteria 2309
51 Ga0466704_370533 3300042643 Bacteria 8825
52 Ga0160472_100216 3300012839 Bacteria 71370
53 Ga0160457_1000011 3300012858 Bacteria 473286
54 Ga0415639_037935 3300038395 Bacteria 5889
55 Ga0466694_269913 3300042594 Bacteria 2615
56 Ga0466711_070230 3300042615 Bacteria 10123
57 Ga0466711_470748 3300042615 Bacteria 1603
58 Ga0466723_061125 3300042618 Bacteria 23742
59 IMNBL1DRAFT_c0000439 3300000062 Bacteria 34888
60 IMNBL1DRAFT_c0008328 3300000062 Bacteria 5292
61 Ga0072940_1136866 3300005200 Bacteria 6378
62 Ga0123356_10000004 3300010049 Bacteria 279505
63 Ga0123353_10540848 3300010167 Bacteria 1683
64 Ga0123354_10218294 3300010882 Bacteria 2035
65 Ga0466701_043591 3300042598 Bacteria 136062
66 Ga0466706_113727 3300042599 Bacteria 10572
67 Ga0466707_307245 3300042601 Bacteria 4814
68 Ga0466722_026750 3300042609 Bacteria 12487
69 Ga0466698_484736 3300042610 Bacteria 74014
70 Ga0466703_195258 3300042636 Unclassified 9956
71 Ga0160440_100036 3300012815 Bacteria 212163
72 Ga0160468_100014 3300012819 Bacteria 337370
73 Ga0160460_103571 3300012845 Unclassified 2697
74 Ga0160436_1000387 3300012861 Bacteria 18358
75 2227100264 2225789004 Bacteria 9598
76 2227468797 2225789004 Bacteria 4992
77 Ga0072941_1199212 3300005201 Unclassified 4424
78 Ga0123355_10007281 3300009826 Bacteria 16551
79 Ga0123353_10003141 3300010167 Bacteria 20741
80 Ga0466719_356811 3300042606 Bacteria 87047
81 Ga0466704_600647 3300042643 Bacteria 3296
82 Ga0466724_30557 3300042649 Bacteria 15145
83 Ga0160456_101376 3300012820 Bacteria 5762
84 Ga0160448_100020 3300012854 Bacteria 209256
85 Ga0160435_1000170 3300012857 Unclassified 34270
86 Ga0466657_283094 3300042582 Bacteria 1169
87 Ga0466710_112291 3300042613 Bacteria 1087
88 Ga0466715_083219 3300042616 Bacteria 9361
89 2227516594 2225789004 Bacteria 3431
90 IMNBL1DRAFT_c0001403 3300000062 Bacteria 18075
91 Ga0123357_10134293 3300009784 Bacteria 3066
92 Ga0123355_10098456 3300009826 Bacteria 4612
93 Ga0123355_10467039 3300009826 Bacteria 1579
94 Ga0123356_10191408 3300010049 Bacteria 2077
95 Ga0123356_10691366 3300010049 Bacteria 1189
96 Ga0466714_167642 3300042603 Bacteria 1548
97 Ga0466734_116170 3300042623 Bacteria 6138
98 Ga0466704_460508 3300042643 Bacteria 2131
99 Ga0160446_101218 3300012835 Unclassified 5950
100 Ga0160434_124247 3300012850 Unclassified 901
101 Ga0160448_100112 3300012854 Bacteria 39659
102 Ga0160435_1000168 3300012857 Bacteria 34415
103 Ga0264413_139546 3300024493 Bacteria 7861
104 Ga0415639_003541 3300038395 Unclassified 32696
105 Ga0415639_007187 3300038395 Bacteria 65568
106 Ga0415639_028875 3300038395 Bacteria 12597
107 Ga0415639_213128 3300038395 Bacteria 1949
108 Ga0466690_147069 3300042590 Bacteria 2369
109 Ga0466690_392135 3300042590 Unclassified 4587
110 Ga0466696_456821 3300042596 Bacteria 9077
111 Ga0466710_123865 3300042613 Bacteria 2046
112 Ga0466726_268767 3300042619 Bacteria 1063
113 JGI24702J35022_10020032 3300002462 Bacteria 3635
114 Ga0123356_10032866 3300010049 Bacteria 4852
115 Ga0123356_10059071 3300010049 Bacteria 3577
116 Ga0123356_10143220 3300010049 Bacteria 2361
117 Ga0123353_10143386 3300010167 Bacteria 3824
118 Ga0123353_10190501 3300010167 Bacteria 3238
119 Ga0466714_020879 3300042603 Bacteria 19595
120 Ga0466714_051330 3300042603 Bacteria 34645
121 Ga0466704_144161 3300042643 Bacteria 9547
122 Ga0466708_202565 3300042652 Bacteria 9160
123 Ga0415639_016409 3300038395 Bacteria 11228
124 Ga0415639_134060 3300038395 Bacteria 1981
125 Ga0466657_079224 3300042582 Bacteria 2800
126 Ga0466694_013756 3300042594 Bacteria 1077
127 Ga0466710_082703 3300042613 Bacteria 7378
128 Ga0466723_075173 3300042618 Bacteria 100663
129 Ga0466726_202831 3300042619 Bacteria 29890
130 AustNasuHG_c1000666 3300000089 Bacteria 12208

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820332331 2820333596 196
2 3300042616 Ga0466715_083219 Ga0466715_083219_3924_4577 217
3 3300042594 Ga0466694_013756 Ga0466694_013756_23_679 218
4 3300038395 Ga0415639_002710 Ga0415639_002710_16921_17580 219
5 3300038395 Ga0415639_007187 Ga0415639_007187_2063_2722 219
6 iso_pr_bacteria 2820373881 2820375243 219
7 iso_pr_bacteria 2820453354 2820453845 219
8 iso_pr_bacteria 2820463629 2820464530 219
9 3300010049 Ga0123356_10032866 Ga0123356_100328664 220
10 3300010167 Ga0123353_10000210 Ga0123353_100002102 220
11 3300010167 Ga0123353_10370409 Ga0123353_103704093 220
12 3300038395 Ga0415639_213128 Ga0415639_213128_1214_1876 220
13 iso_pr_bacteria 2820255904 2820257066 220
14 iso_pr_bacteria 2820570671 2820570768 220
15 3300000089 AustNasuHG_c1000666 AustNasuHG_100066612 221
16 3300005200 Ga0072940_1136866 Ga0072940_11368661 221
17 3300010049 Ga0123356_10143220 Ga0123356_101432204 221
18 3300042619 Ga0466726_268767 Ga0466726_268767_136_837 221
19 2225789004 2227671816 2228277424 222
20 iso_pr_bacteria 2820244222 2820245013 222
21 3300042594 Ga0466694_269913 Ga0466694_269913_1436_2110 224
22 3300010167 Ga0123353_10400987 Ga0123353_104009872 225
23 3300038395 Ga0415639_037935 Ga0415639_037935_2213_2890 225
24 3300038395 Ga0415639_016409 Ga0415639_016409_5754_6434 226
25 iso_pr_bacteria 2820333861 2820335338 226
26 iso_pr_bacteria 2820391468 2820392757 226
27 2225789004 2227468797 2227911402 227
28 3300010049 Ga0123356_10059071 Ga0123356_100590714 227
29 3300010167 Ga0123353_10000072 Ga0123353_1000007295 227
30 2225789004 2227516594 2228016076 228
31 3300002462 JGI24702J35022_10020032 JGI24702J35022_100200324 228
32 3300038395 Ga0415639_134060 Ga0415639_134060_1260_1946 228
33 3300000062 IMNBL1DRAFT_c0000439 IMNBL1DRAFT_000043918 229
34 3300000062 IMNBL1DRAFT_c0001403 IMNBL1DRAFT_000140312 229
35 3300005201 Ga0072941_1049497 Ga0072941_10494971 229
36 3300005201 Ga0072941_1199212 Ga0072941_11992124 229
37 3300042636 Ga0466703_422853 Ga0466703_422853_3316_4005 229
38 3300012858 Ga0160457_1000011 Ga0160457_100001165 230
39 3300042596 Ga0466696_456821 Ga0466696_456821_8090_8782 230
40 3300042606 Ga0466719_513919 Ga0466719_513919_881_1573 230
41 3300042612 Ga0466705_324574 Ga0466705_324574_1252_1944 230
42 3300042618 Ga0466723_069866 Ga0466723_069866_2185_2877 230
43 3300042619 Ga0466726_202831 Ga0466726_202831_1702_2394 230
44 3300042643 Ga0466704_173547 Ga0466704_173547_3005_3697 230
45 3300042643 Ga0466704_370533 Ga0466704_370533_5935_6627 230
46 3300042643 Ga0466704_537415 Ga0466704_537415_7103_7795 230
47 3300010049 Ga0123356_10002553 Ga0123356_1000255315 231
48 3300010167 Ga0123353_10521781 Ga0123353_105217812 231
49 3300042590 Ga0466690_392135 Ga0466690_392135_1549_2244 231
50 3300042603 Ga0466714_014223 Ga0466714_014223_2603_3298 231
51 3300042603 Ga0466714_082025 Ga0466714_082025_1589_2284 231
52 3300042606 Ga0466719_187149 Ga0466719_187149_2143_2838 231
53 3300042618 Ga0466723_061125 Ga0466723_061125_11339_12034 231
54 iso_pr_bacteria 2585428085 2587835984 231
55 3300010167 Ga0123353_10143386 Ga0123353_101433865 232
56 3300042603 Ga0466714_167642 Ga0466714_167642_531_1229 232
57 3300042613 Ga0466710_123865 Ga0466710_123865_721_1419 232
58 3300042616 Ga0466715_184305 Ga0466715_184305_2039_2737 232
59 iso_pr_bacteria 2820254385 2820254775 232
60 iso_pr_bacteria 2820257794 2820259543 232
61 3300042590 Ga0466690_147069 Ga0466690_147069_216_917 233
62 3300009784 Ga0123357_10134293 Ga0123357_101342932 234
63 3300042600 Ga0466700_097737 Ga0466700_097737_21140_21847 235
64 3300042603 Ga0466714_020879 Ga0466714_020879_8126_8833 235
65 3300042603 Ga0466714_051330 Ga0466714_051330_7448_8155 235
66 3300042613 Ga0466710_112291 Ga0466710_112291_231_938 235
67 3300042615 Ga0466711_070230 Ga0466711_070230_7540_8247 235
68 3300042615 Ga0466711_470748 Ga0466711_470748_444_1151 235
69 3300042618 Ga0466723_075173 Ga0466723_075173_50640_51347 235
70 3300042619 Ga0466726_367050 Ga0466726_367050_4367_5074 235
71 3300042636 Ga0466703_195258 Ga0466703_195258_1105_1812 235
72 3300042643 Ga0466704_336982 Ga0466704_336982_358_1065 235
73 3300042643 Ga0466704_460508 Ga0466704_460508_359_1066 235
74 3300042652 Ga0466708_202565 Ga0466708_202565_4854_5561 235
75 iso_pr_bacteria 642555127 642611657 235
76 3300042582 Ga0466657_079224 Ga0466657_079224_1668_2378 236
77 3300042623 Ga0466734_116170 Ga0466734_116170_4227_4937 236
78 3300000062 IMNBL1DRAFT_c0008328 IMNBL1DRAFT_00083283 237
79 3300042620 Ga0466728_226061 Ga0466728_226061_7302_8015 237
80 iso_pr_bacteria 2820271343 2820272014 237
81 iso_pr_bacteria 2864755708 2864760408 237
82 3300009826 Ga0123355_10140569 Ga0123355_101405692 238
83 3300010049 Ga0123356_10000004 Ga0123356_1000000498 238
84 3300042582 Ga0466657_064791 Ga0466657_064791_10286_11002 238
85 iso_pr_bacteria 2548876789 2549849619 238
86 iso_pr_bacteria 2873562573 2873564955 238
87 iso_pr_bacteria 2889908211 2889909244 238
88 3300010167 Ga0123353_10190501 Ga0123353_101905013 239
89 3300012819 Ga0160468_100612 Ga0160468_1006123 239
90 3300012837 Ga0160455_100080 Ga0160455_10008014 239
91 3300012845 Ga0160460_103571 Ga0160460_1035712 239
92 3300012846 Ga0160433_100648 Ga0160433_1006483 239
93 3300012861 Ga0160436_1000387 Ga0160436_100038717 239
94 2084038013 AglaG_contig14211 AglaG_01555890 240
95 3300007505 Ga0105005_1280275 Ga0105005_12802752 240
96 3300010167 Ga0123353_10540848 Ga0123353_105408481 240
97 3300012820 Ga0160456_100030 Ga0160456_100030192 240
98 3300042659 Ga0466733_071974 Ga0466733_071974_3993_4715 240
99 3300012820 Ga0160456_101376 Ga0160456_1013765 241
100 3300042582 Ga0466657_283094 Ga0466657_283094_116_841 241
101 3300042598 Ga0466701_043591 Ga0466701_043591_103508_104233 241
102 3300042649 Ga0466724_15911 Ga0466724_15911_9812_10537 241
103 3300042649 Ga0466724_30557 Ga0466724_30557_9876_10601 241
104 3300012835 Ga0160446_101218 Ga0160446_1012183 242
105 3300012845 Ga0160460_100170 Ga0160460_10017068 242
106 3300012850 Ga0160434_124247 Ga0160434_1242472 242
107 2225789004 2227100264 2227483500 243
108 3300012839 Ga0160472_100216 Ga0160472_1002165 243
109 3300012854 Ga0160448_100112 Ga0160448_10011212 243
110 3300012857 Ga0160435_1000170 Ga0160435_100017025 243
111 3300010882 Ga0123354_10218294 Ga0123354_102182942 244
112 3300012815 Ga0160440_100036 Ga0160440_100036193 244
113 3300038395 Ga0415639_001497 Ga0415639_001497_34419_35153 244
114 3300042599 Ga0466706_113727 Ga0466706_113727_9550_10284 244
115 3300042599 Ga0466706_131602 Ga0466706_131602_32_766 244
116 3300042659 Ga0466733_084045 Ga0466733_084045_1282_2061 244
117 3300010049 Ga0123356_10191408 Ga0123356_101914082 245
118 3300012824 Ga0160469_100016 Ga0160469_100016147 245
119 3300012845 Ga0160460_100119 Ga0160460_10011960 245
120 3300012854 Ga0160448_100020 Ga0160448_10002090 245
121 3300012857 Ga0160435_1000168 Ga0160435_10001689 246
122 3300038395 Ga0415639_028875 Ga0415639_028875_7449_8189 246
123 3300038395 Ga0415639_003541 Ga0415639_003541_14897_15640 247
124 3300042601 Ga0466707_139759 Ga0466707_139759_2029_2772 247
125 3300042621 Ga0466729_252457 Ga0466729_252457_1210_1983 247
126 iso_pr_bacteria 2820292184 2820293909 247
127 3300010167 Ga0123353_10003141 Ga0123353_1000314114 249
128 3300010167 Ga0123353_10635613 Ga0123353_106356132 249
129 3300012819 Ga0160468_100014 Ga0160468_10001478 249
130 iso_pr_bacteria 2820021908 2820022155 250
131 3300010167 Ga0123353_10557922 Ga0123353_105579222 251
132 3300010167 Ga0123353_10635531 Ga0123353_106355312 251
133 3300042613 Ga0466710_082703 Ga0466710_082703_2601_3359 252
134 3300042601 Ga0466707_307245 Ga0466707_307245_1397_2248 255
135 3300042612 Ga0466705_221965 Ga0466705_221965_9376_10146 256
136 3300042617 Ga0466718_016583 Ga0466718_016583_1810_2580 256
137 3300042643 Ga0466704_144161 Ga0466704_144161_1281_2051 256
138 iso_pr_bacteria 2820342392 2820342820 257
139 3300009826 Ga0123355_10007281 Ga0123355_1000728110 258
140 3300010049 Ga0123356_10001976 Ga0123356_100019763 258
141 3300009826 Ga0123355_10098456 Ga0123355_100984564 262
142 3300009826 Ga0123355_10467039 Ga0123355_104670392 264
143 3300042599 Ga0466706_191400 Ga0466706_191400_32492_33286 264
144 3300024493 Ga0264413_139546 Ga0264413_1395465 266
145 3300009826 Ga0123355_10374968 Ga0123355_103749682 269
146 3300042643 Ga0466704_600647 Ga0466704_600647_128_1195 269
147 3300010049 Ga0123356_10691366 Ga0123356_106913662 270
148 3300042610 Ga0466698_484736 Ga0466698_484736_12389_13216 275
149 3300042606 Ga0466719_356811 Ga0466719_356811_18466_19404 276
150 3300042609 Ga0466722_026750 Ga0466722_026750_10898_11752 276
151 3300009826 Ga0123355_10028795 Ga0123355_100287957 292

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 27 175 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.