Protein Family IF06565

Metagenome Isolate
130 Members
39 Samples
126 Scaffolds
300.18 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_353451|Ga0466719_353451_934_1926
Length
330 aa
Sequence
LIFFANIPKEALYLQEGFSDFRFSTSNYQSAIINQQLQLATTNIAFILNPVSGAKQKRKIPLLIRRFFTYGKGFRVTFYRTKAAGDATVMAKKFADENYDIVVAIGGDGTVNEVAQALVNTNTALGIVPVGSGNGLARHLHIPMNPCKALRHIATAKTCRADYGLMNGIPFFCTAGVGFDALIGNRFAQANSRGFATYLRKILREFVLYKPEEYNLTIDGKAMRRKAFLITFANASQWGNNAYIAPTASVSDGLLDVVVLSKFPLYRAPNIGLRLFTRQIDKLRYIEIFRCRSAAVDRVNSGYIHYDGEPSQTGKHVEVKLVQGALKIVS

📊 Sample Types

Isolate 3.1%
Metagenome 96.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 37.8%
Termitidae 27.0%
Termopsidae 10.8%
Unclassified 10.8%
Rhinotermitidae 8.1%
Elmidae 2.7%
Passalidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
25 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 2864836148 Arcicella rosea S00070 Isolate Elmidae
35 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_135310 3300042612 Bacteria 16326
2 Ga0466691_007727 3300042593 Bacteria 6350
3 Ga0466691_049444 3300042593 Bacteria 8307
4 Ga0466696_004260 3300042596 Bacteria 14834
5 Ga0466696_069457 3300042596 Bacteria 4385
6 Ga0466722_029205 3300042609 Bacteria 12757
7 Ga0466703_138229 3300042636 Bacteria 4282
8 Ga0466704_154752 3300042643 Bacteria 10999
9 Ga0466708_046334 3300042652 Bacteria 5095
10 Ga0123353_10301251 3300010167 Bacteria 2447
11 Ga0072941_1153562 3300005201 Bacteria 2974
12 Ga0466690_042796 3300042590 Bacteria 1849
13 Ga0466690_067936 3300042590 Bacteria 3860
14 Ga0466691_139551 3300042593 Bacteria 6840
15 Ga0466696_382463 3300042596 Bacteria 6021
16 Ga0466711_147405 3300042615 Bacteria 3562
17 Ga0466715_016833 3300042616 Unclassified 1868
18 Ga0466723_180367 3300042618 Bacteria 8932
19 Ga0466728_245329 3300042620 Bacteria 20586
20 Ga0466728_273661 3300042620 Bacteria 3969
21 Ga0466701_074418 3300042598 Unclassified 1142
22 Ga0466719_386076 3300042606 Bacteria 1828
23 Ga0466721_035223 3300042608 Bacteria 7980
24 Ga0466703_026427 3300042636 Bacteria 3086
25 Ga0466703_098340 3300042636 Unclassified 2403
26 Ga0466704_270615 3300042643 Bacteria 12284
27 Ga0466709_071215 3300042648 Bacteria 2925
28 Ga0072940_1132501 3300005200 Bacteria 2681
29 Ga0466692_098494 3300042591 Bacteria 22280
30 Ga0466692_153897 3300042591 Bacteria 2302
31 Ga0466691_075227 3300042593 Bacteria 47930
32 Ga0466705_479348 3300042612 Bacteria 1869
33 Ga0466715_135674 3300042616 Bacteria 34654
34 Ga0466716_220577 3300042605 Bacteria 1481
35 Ga0466719_158614 3300042606 Bacteria 13617
36 Ga0466722_056019 3300042609 Bacteria 7648
37 Ga0466722_179154 3300042609 Bacteria 5732
38 Ga0466704_502987 3300042643 Bacteria 3153
39 Ga0466709_418744 3300042648 Bacteria 33430
40 Ga0466708_129025 3300042652 Bacteria 2726
41 Ga0466708_247204 3300042652 Bacteria 3962
42 Ga0466727_040229 3300042655 Bacteria 42184
43 JGI24702J35022_10006761 3300002462 Bacteria 6608
44 Ga0068302_10257068 3300005071 Bacteria 1938
45 Ga0466705_040205 3300042612 Bacteria 13238
46 Ga0466690_227975 3300042590 Bacteria 7617
47 Ga0466711_039341 3300042615 Bacteria 6951
48 Ga0466715_142600 3300042616 Bacteria 6912
49 Ga0466715_384156 3300042616 Bacteria 12865
50 Ga0466715_427455 3300042616 Bacteria 20949
51 Ga0466723_370516 3300042618 Bacteria 6896
52 Ga0466728_473676 3300042620 Bacteria 1379
53 Ga0466716_166157 3300042605 Bacteria 8588
54 Ga0466719_178671 3300042606 Bacteria 1907
55 Ga0466719_476030 3300042606 Bacteria 3505
56 Ga0466722_219312 3300042609 Bacteria 3486
57 Ga0466735_194091 3300042624 Bacteria 2431
58 Ga0466703_028462 3300042636 Bacteria 9939
59 Ga0466704_345396 3300042643 Bacteria 5067
60 Ga0466704_378585 3300042643 Bacteria 15811
61 Ga0466709_157485 3300042648 Bacteria 3163
62 Ga0466725_013252 3300042654 Bacteria 1304
63 JGI24702J35022_10039326 3300002462 Bacteria 2524
64 JGI24696J40584_12958543 3300002834 Bacteria 4220
65 Ga0466696_211475 3300042596 Bacteria 24790
66 Ga0466715_016941 3300042616 Bacteria 2017
67 Ga0466723_110495 3300042618 Bacteria 37799
68 Ga0466726_153274 3300042619 Bacteria 9457
69 Ga0466726_371988 3300042619 Bacteria 3377
70 Ga0466728_210940 3300042620 Unclassified 1733
71 Ga0466728_458778 3300042620 Bacteria 6779
72 Ga0466716_050747 3300042605 Bacteria 3114
73 Ga0466716_264542 3300042605 Bacteria 4238
74 Ga0466729_212534 3300042621 Bacteria 2536
75 Ga0466704_168602 3300042643 Bacteria 2500
76 Ga0466709_072865 3300042648 Bacteria 2945
77 Ga0466708_130565 3300042652 Bacteria 5061
78 Ga0123353_10001771 3300010167 Bacteria 26500
79 JGI24698J34947_10094807 3300002449 Bacteria 1359
80 JGI24705J35276_12235603 3300002504 Bacteria 6722
81 Ga0068302_10252585 3300005071 Bacteria 2813
82 Ga0466705_003668 3300042612 Bacteria 18332
83 Ga0466705_022882 3300042612 Unclassified 5774
84 Ga0466705_381272 3300042612 Bacteria 8231
85 Ga0466690_017104 3300042590 Bacteria 4538
86 Ga0466690_154025 3300042590 Bacteria 13948
87 Ga0466696_092398 3300042596 Bacteria 31103
88 Ga0466723_212200 3300042618 Bacteria 13278
89 Ga0466723_234847 3300042618 Bacteria 21485
90 Ga0466726_108489 3300042619 Bacteria 15292
91 Ga0466728_358989 3300042620 Bacteria 1463
92 Ga0466716_051923 3300042605 Bacteria 5900
93 Ga0466716_137715 3300042605 Bacteria 5089
94 Ga0466703_282481 3300042636 Bacteria 3999
95 Ga0466704_182939 3300042643 Bacteria 26244
96 Ga0466727_279126 3300042655 Bacteria 1657
97 Ga0072941_1292304 3300005201 Bacteria 9326
98 Ga0466690_363310 3300042590 Bacteria 7394
99 Ga0466691_091844 3300042593 Bacteria 8001
100 Ga0466691_119216 3300042593 Bacteria 6096
101 Ga0466696_471991 3300042596 Bacteria 8662
102 Ga0466723_164021 3300042618 Bacteria 38027
103 Ga0466726_387149 3300042619 Bacteria 5604
104 Ga0466719_317563 3300042606 Bacteria 2745
105 Ga0466722_173646 3300042609 Bacteria 9212
106 Ga0466708_070580 3300042652 Bacteria 12677
107 Ga0466708_254328 3300042652 Bacteria 25412
108 Ga0123356_10055991 3300010049 Bacteria 3673
109 Ga0466705_035023 3300042612 Bacteria 11255
110 Ga0264413_138977 3300024493 Unclassified 5108
111 Ga0466690_045264 3300042590 Bacteria 3234
112 Ga0466690_214270 3300042590 Bacteria 1194
113 Ga0466692_044295 3300042591 Bacteria 27264
114 Ga0466691_153285 3300042593 Bacteria 8534
115 Ga0466711_184269 3300042615 Bacteria 13134
116 Ga0466715_018387 3300042616 Unclassified 4572
117 Ga0466723_038825 3300042618 Bacteria 14509
118 Ga0466728_125242 3300042620 Bacteria 3095
119 Ga0466713_017933 3300042602 Bacteria 9255
120 Ga0466719_353451 3300042606 Bacteria 5925
121 Ga0466703_121476 3300042636 Bacteria 4568
122 Ga0466704_362206 3300042643 Bacteria 17907
123 Ga0466708_025157 3300042652 Bacteria 15972
124 Ga0466708_095754 3300042652 Bacteria 2832
125 Ga0123353_11076866 3300010167 Bacteria 1070
126 IMNBL1DRAFT_c0002439 3300000062 Bacteria 12943

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042598 Ga0466701_074418 Ga0466701_074418_393_1127 244
2 3300042593 Ga0466691_153285 Ga0466691_153285_394_1203 269
3 3300042596 Ga0466696_092398 Ga0466696_092398_18654_19469 271
4 3300042612 Ga0466705_135310 Ga0466705_135310_6356_7186 276
5 3300005200 Ga0072940_1132501 Ga0072940_11325013 278
6 3300042636 Ga0466703_121476 Ga0466703_121476_3518_4363 281
7 iso_pr_bacteria 2864836148 2864840479 283
8 3300042648 Ga0466709_157485 Ga0466709_157485_2007_2867 286
9 3300005071 Ga0068302_10252585 Ga0068302_102525853 287
10 3300042619 Ga0466726_108489 Ga0466726_108489_9267_10133 288
11 3300042655 Ga0466727_279126 Ga0466727_279126_517_1383 288
12 3300002834 JGI24696J40584_12958543 JGI24696J40584_129585432 290
13 3300042590 Ga0466690_042796 Ga0466690_042796_516_1388 290
14 3300042590 Ga0466690_154025 Ga0466690_154025_2743_3615 290
15 3300042590 Ga0466690_227975 Ga0466690_227975_452_1324 290
16 3300042606 Ga0466719_317563 Ga0466719_317563_1853_2725 290
17 3300042606 Ga0466719_476030 Ga0466719_476030_1845_2717 290
18 3300042616 Ga0466715_427455 Ga0466715_427455_16421_17293 290
19 3300042618 Ga0466723_110495 Ga0466723_110495_11878_12750 290
20 3300042618 Ga0466723_164021 Ga0466723_164021_16802_17674 290
21 3300042620 Ga0466728_458778 Ga0466728_458778_3792_4664 290
22 3300042621 Ga0466729_212534 Ga0466729_212534_1554_2426 290
23 3300010167 Ga0123353_10301251 Ga0123353_103012513 291
24 3300042609 Ga0466722_173646 Ga0466722_173646_1700_2575 291
25 3300005201 Ga0072941_1292304 Ga0072941_12923043 292
26 3300010167 Ga0123353_10001771 Ga0123353_100017716 292
27 3300010167 Ga0123353_11076866 Ga0123353_110768662 292
28 3300042596 Ga0466696_211475 Ga0466696_211475_15638_16516 292
29 3300042609 Ga0466722_029205 Ga0466722_029205_768_1646 292
30 3300042619 Ga0466726_387149 Ga0466726_387149_3175_4053 292
31 3300000062 IMNBL1DRAFT_c0002439 IMNBL1DRAFT_00024391 293
32 3300042593 Ga0466691_007727 Ga0466691_007727_4867_5748 293
33 3300042593 Ga0466691_075227 Ga0466691_075227_31758_32639 293
34 3300042593 Ga0466691_119216 Ga0466691_119216_3947_4828 293
35 3300042605 Ga0466716_050747 Ga0466716_050747_2177_3058 293
36 3300042605 Ga0466716_264542 Ga0466716_264542_1119_2000 293
37 3300042606 Ga0466719_178671 Ga0466719_178671_254_1135 293
38 3300042612 Ga0466705_003668 Ga0466705_003668_7117_7998 293
39 3300042612 Ga0466705_040205 Ga0466705_040205_3785_4666 293
40 3300042616 Ga0466715_016833 Ga0466715_016833_596_1477 293
41 3300042616 Ga0466715_016941 Ga0466715_016941_597_1478 293
42 3300042616 Ga0466715_018387 Ga0466715_018387_1569_2450 293
43 3300042618 Ga0466723_234847 Ga0466723_234847_11076_11957 293
44 3300042620 Ga0466728_125242 Ga0466728_125242_1147_2028 293
45 3300042624 Ga0466735_194091 Ga0466735_194091_523_1404 293
46 3300042643 Ga0466704_168602 Ga0466704_168602_582_1463 293
47 3300042652 Ga0466708_130565 Ga0466708_130565_1681_2562 293
48 3300042655 Ga0466727_040229 Ga0466727_040229_39252_40133 293
49 3300042596 Ga0466696_069457 Ga0466696_069457_2538_3422 294
50 3300042596 Ga0466696_382463 Ga0466696_382463_1158_2042 294
51 3300042609 Ga0466722_179154 Ga0466722_179154_4071_4955 294
52 3300042612 Ga0466705_035023 Ga0466705_035023_6528_7412 294
53 3300042643 Ga0466704_154752 Ga0466704_154752_9715_10599 294
54 3300042652 Ga0466708_046334 Ga0466708_046334_2079_2963 294
55 3300042652 Ga0466708_254328 Ga0466708_254328_6235_7119 294
56 3300042654 Ga0466725_013252 Ga0466725_013252_141_1025 294
57 iso_pr_bacteria 2820772500 2820772581 294
58 3300042615 Ga0466711_147405 Ga0466711_147405_2209_3135 295
59 3300042636 Ga0466703_098340 Ga0466703_098340_1084_1971 295
60 iso_pr_bacteria 2820748953 2820749618 295
61 iso_pr_bacteria 2820781750 2820783300 295
62 3300002449 JGI24698J34947_10094807 JGI24698J34947_100948071 296
63 3300002462 JGI24702J35022_10039326 JGI24702J35022_100393262 296
64 3300002504 JGI24705J35276_12235603 JGI24705J35276_122356031 296
65 3300005201 Ga0072941_1153562 Ga0072941_11535624 296
66 3300010049 Ga0123356_10055991 Ga0123356_100559914 296
67 3300042643 Ga0466704_378585 Ga0466704_378585_6493_7383 296
68 3300002462 JGI24702J35022_10006761 JGI24702J35022_100067612 297
69 3300042591 Ga0466692_044295 Ga0466692_044295_22655_23548 297
70 3300042602 Ga0466713_017933 Ga0466713_017933_5243_6136 297
71 3300042636 Ga0466703_026427 Ga0466703_026427_1360_2253 297
72 3300042643 Ga0466704_345396 Ga0466704_345396_2734_3627 297
73 3300042643 Ga0466704_502987 Ga0466704_502987_1475_2368 297
74 3300042648 Ga0466709_418744 Ga0466709_418744_5100_6056 299
75 3300042596 Ga0466696_004260 Ga0466696_004260_8468_9373 301
76 3300024493 Ga0264413_138977 Ga0264413_1389773 304
77 3300042591 Ga0466692_153897 Ga0466692_153897_194_1108 304
78 3300042615 Ga0466711_184269 Ga0466711_184269_9443_10357 304
79 3300042619 Ga0466726_153274 Ga0466726_153274_249_1163 304
80 3300042590 Ga0466690_214270 Ga0466690_214270_246_1163 305
81 3300042612 Ga0466705_381272 Ga0466705_381272_3186_4103 305
82 3300042620 Ga0466728_210940 Ga0466728_210940_15_932 305
83 3300042590 Ga0466690_363310 Ga0466690_363310_4515_5435 306
84 3300042593 Ga0466691_049444 Ga0466691_049444_281_1201 306
85 3300042593 Ga0466691_139551 Ga0466691_139551_2350_3270 306
86 3300042609 Ga0466722_056019 Ga0466722_056019_5245_6165 306
87 3300042618 Ga0466723_212200 Ga0466723_212200_12261_13181 306
88 3300042618 Ga0466723_370516 Ga0466723_370516_4487_5407 306
89 3300042620 Ga0466728_245329 Ga0466728_245329_10520_11440 306
90 3300042620 Ga0466728_273661 Ga0466728_273661_3035_3955 306
91 3300042636 Ga0466703_028462 Ga0466703_028462_4930_5850 306
92 3300042636 Ga0466703_282481 Ga0466703_282481_94_1014 306
93 3300042652 Ga0466708_025157 Ga0466708_025157_203_1123 306
94 3300042652 Ga0466708_095754 Ga0466708_095754_1604_2524 306
95 3300042590 Ga0466690_045264 Ga0466690_045264_1929_2852 307
96 3300042605 Ga0466716_220577 Ga0466716_220577_390_1316 308
97 3300042616 Ga0466715_384156 Ga0466715_384156_10275_11201 308
98 3300042590 Ga0466690_067936 Ga0466690_067936_894_1823 309
99 3300042605 Ga0466716_166157 Ga0466716_166157_2686_3615 309
100 3300042618 Ga0466723_180367 Ga0466723_180367_5733_6662 309
101 3300042612 Ga0466705_022882 Ga0466705_022882_2832_3764 310
102 3300042616 Ga0466715_135674 Ga0466715_135674_10585_11517 310
103 3300042643 Ga0466704_270615 Ga0466704_270615_7091_8023 310
104 3300042591 Ga0466692_098494 Ga0466692_098494_15263_16198 311
105 3300042605 Ga0466716_137715 Ga0466716_137715_4097_5032 311
106 3300042643 Ga0466704_182939 Ga0466704_182939_12210_13145 311
107 3300042609 Ga0466722_219312 Ga0466722_219312_2378_3316 312
108 3300042652 Ga0466708_129025 Ga0466708_129025_451_1389 312
109 3300042652 Ga0466708_247204 Ga0466708_247204_1785_2723 312
110 3300042605 Ga0466716_051923 Ga0466716_051923_4541_5485 314
111 3300042606 Ga0466719_158614 Ga0466719_158614_7761_8708 315
112 3300042606 Ga0466719_386076 Ga0466719_386076_832_1779 315
113 3300042620 Ga0466728_473676 Ga0466728_473676_314_1261 315
114 3300042643 Ga0466704_362206 Ga0466704_362206_10349_11296 315
115 3300042648 Ga0466709_072865 Ga0466709_072865_1718_2665 315
116 3300042652 Ga0466708_070580 Ga0466708_070580_11680_12627 315
117 3300042648 Ga0466709_071215 Ga0466709_071215_567_1520 317
118 3300042590 Ga0466690_017104 Ga0466690_017104_3462_4418 318
119 3300042636 Ga0466703_138229 Ga0466703_138229_287_1243 318
120 3300042612 Ga0466705_479348 Ga0466705_479348_648_1616 322
121 3300042615 Ga0466711_039341 Ga0466711_039341_4218_5186 322
122 3300005071 Ga0068302_10257068 Ga0068302_102570682 323
123 3300042618 Ga0466723_038825 Ga0466723_038825_11746_12717 323
124 3300042608 Ga0466721_035223 Ga0466721_035223_6640_7614 324
125 3300042596 Ga0466696_471991 Ga0466696_471991_1982_2962 326
126 3300042593 Ga0466691_091844 Ga0466691_091844_6736_7755 327
127 3300042619 Ga0466726_371988 Ga0466726_371988_1755_2738 327
128 3300042620 Ga0466728_358989 Ga0466728_358989_261_1247 328
129 3300042606 Ga0466719_353451 Ga0466719_353451_934_1926 330
130 3300042616 Ga0466715_142600 Ga0466715_142600_1841_2833 330

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00781 DAGK_cat Diacylglycerol kinase catalytic domain 44 164 0.95
PF19279 YegS_C YegS C-terminal NAD kinase beta sandwich-like domain 176 329 0.9
PF01513 NAD_kinase ATP-NAD kinase N-terminal domain 80 120 0.8

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00781 GO:0016301 kinase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.