Protein Family IF06554

Metagenome Isolate
238 Members
93 Samples
197 Scaffolds
388.93 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_325729|Ga0466719_325729_3197_4579
Length
460 aa
Sequence
MMLESGRTRKIAVLGSSGSIGRSALDVIALSQGTLEVVLLSVNRQTNILAEQLQQIAANIASNKLATNSVNKNQKNIMRMPQWIVVTDSDADRAPLEKLPSEILSETKIFYGQDSLSLLVREPEIDIVLSAVSGCAGLASTWSALEAGKIVALANKESLVSGGSMIKEVAEKNRGNLIPVDSEHSAVWQALQSWRMQHYPNSLINPDMNKTANKHSDLSLNPQNSACISVRQNVYNTDPRNVIDNITLTASGGPFRTWTLDELKKVTVTDALNHPTWKMGSKITVDSATMMNKAFEIIEASYLFDLDSCNIKVLIHPQSIVHSMVQFIDGSVVAQLSRPDMRIPISIALHYPERFELPVCPIDWSEKVSLEFYMPDFERFPAISLGYAVSDKGGTAGAVVNAANETAINAFLNGRLPFYDIVNACISVLENHNFEKRPTLSRLLELDTWARKETEKWISQ

📊 Sample Types

Isolate 17.2%
Metagenome 82.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.9%
Unclassified 19.6%
Kalotermitidae 15.2%
Elmidae 6.5%
Pyralidae 5.4%
Termopsidae 4.3%
Passalidae 3.3%
Rhinotermitidae 3.3%
Scarabaeidae 2.2%
Formicidae 2.2%
Bombycidae 2.2%
Curculionidae 1.1%
Tenebrionidae 1.1%
Noctuidae 1.1%
Eresidae 1.1%
Culicidae 1.1%
Stratiomyidae 1.1%
Portunidae 1.1%
Ocypodidae 1.1%
Cimicidae 1.1%
Porcellionidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 227
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
2 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
3 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
4 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
7 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
8 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
9 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
12 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
13 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
14 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
15 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
16 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
17 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
18 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 8022725327 Bacillus sp. SN10 Isolate Eresidae
23 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
24 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
25 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
26 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
27 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
28 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
29 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
30 2969145278 Bacillus cereus 29 Isolate Portunidae
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
33 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
34 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
35 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
36 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
37 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
38 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
39 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
40 2978778678 Bacillus cereus 25 Isolate Ocypodidae
41 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
42 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
46 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
47 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
48 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
49 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
50 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
51 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
52 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
53 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
54 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
55 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
56 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
57 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
58 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
59 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
60 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
61 8073539042 Candidatus Rhabdochlamydia porcellionis 15C Isolate Porcellionidae
62 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
63 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
64 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
65 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
66 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
67 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
68 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
69 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
70 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
71 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
72 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
73 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
74 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
75 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
76 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
77 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
78 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
79 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
80 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
81 3300026558 Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 Metagenome Formicidae
82 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
83 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
84 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
85 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
86 2537562000 Bacillus cereus HD73 Isolate Pyralidae
87 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
88 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
89 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
90 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
91 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
92 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
93 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_377825 3300042612 Bacteria 346954
2 Ga0562375_0863 3300056856 Bacteria 50054
3 2227461360 2225789004 Bacteria 5351
4 IMNBL1DRAFT_c0008974 3300000062 Bacteria 5023
5 JGI24695J34938_10004084 3300002450 Bacteria 9752
6 Ga0466692_129576 3300042591 Bacteria 7783
7 Ga0466694_099253 3300042594 Bacteria 11689
8 Ga0466694_154038 3300042594 Bacteria 2154
9 Ga0466699_309712 3300042597 Bacteria 2152
10 Ga0466705_467619 3300042612 Bacteria 4027
11 Ga0466711_270096 3300042615 Bacteria 3052
12 Ga0466715_114009 3300042616 Bacteria 13465
13 Ga0466723_046729 3300042618 Bacteria 2153
14 Ga0466728_250626 3300042620 Bacteria 18456
15 Ga0466729_065558 3300042621 Bacteria 5008
16 Ga0466702_198772 3300042635 Bacteria 2360
17 Ga0466704_336061 3300042643 Bacteria 3938
18 Ga0466725_043029 3300042654 Bacteria 10347
19 Ga0466713_079335 3300042602 Bacteria 100418
20 Ga0466713_087792 3300042602 Bacteria 17055
21 Ga0466716_236915 3300042605 Bacteria 12284
22 Ga0466705_152901 3300042612 Bacteria 18256
23 Ga0466705_321631 3300042612 Bacteria 270475
24 Ga0466733_018838 3300042659 Bacteria 2846
25 IMNBL1DRAFT_c0000440 3300000062 Bacteria 34886
26 Ga0123356_10099014 3300010049 Bacteria 2793
27 Ga0123353_10003195 3300010167 Bacteria 20629
28 Ga0123353_10012731 3300010167 Bacteria 11994
29 Ga0255576_1000001 3300026558 Bacteria 687723
30 Ga0466690_032452 3300042590 Bacteria 13137
31 Ga0466690_313401 3300042590 Bacteria 36055
32 Ga0466696_070358 3300042596 Bacteria 1347
33 Ga0466711_134125 3300042615 Bacteria 100014
34 Ga0466715_063048 3300042616 Bacteria 25995
35 Ga0466723_241706 3300042618 Unclassified 16621
36 Ga0466726_047931 3300042619 Bacteria 81147
37 Ga0466729_018474 3300042621 Bacteria 21916
38 Ga0466735_002449 3300042624 Bacteria 6310
39 Ga0466735_134648 3300042624 Bacteria 3320
40 Ga0466703_250320 3300042636 Bacteria 592480
41 Ga0466704_012048 3300042643 Bacteria 79416
42 Ga0466708_236624 3300042652 Bacteria 31033
43 Ga0466727_347688 3300042655 Unclassified 3534
44 Ga0466713_077401 3300042602 Bacteria 5374
45 Ga0466713_110936 3300042602 Bacteria 53952
46 Ga0466714_112063 3300042603 Bacteria 53411
47 Ga0466722_024175 3300042609 Bacteria 3737
48 Ga0063521_1005672 3300003973 Unclassified 2949
49 Ga0123356_10014972 3300010049 Bacteria 7441
50 Ga0466691_017171 3300042593 Bacteria 24421
51 Ga0466705_471806 3300042612 Bacteria 12054
52 Ga0466723_020100 3300042618 Bacteria 9430
53 Ga0466723_029076 3300042618 Bacteria 5616
54 Ga0466726_065940 3300042619 Bacteria 154230
55 Ga0466726_217236 3300042619 Bacteria 220873
56 Ga0466729_117205 3300042621 Bacteria 50557
57 Ga0466735_029069 3300042624 Bacteria 44652
58 Ga0466702_104040 3300042635 Bacteria 3062
59 Ga0466703_131108 3300042636 Unclassified 74792
60 Ga0466703_271965 3300042636 Bacteria 5815
61 Ga0466703_297371 3300042636 Bacteria 15802
62 Ga0466709_146781 3300042648 Bacteria 32108
63 Ga0466727_172156 3300042655 Bacteria 156225
64 Ga0466707_111198 3300042601 Bacteria 45963
65 Ga0466707_344506 3300042601 Bacteria 2218
66 Ga0466722_202598 3300042609 Bacteria 2507
67 Ga0466705_275974 3300042612 Bacteria 59097
68 2227041496 2225789003 Bacteria 4177
69 Ga0068302_10003016 3300005071 Unclassified 7925
70 Ga0068302_10003017 3300005071 Bacteria 13145
71 Ga0068305_10000200 3300005083 Bacteria 53590
72 Ga0123356_10000001 3300010049 Bacteria 411946
73 Ga0123356_10091749 3300010049 Bacteria 2896
74 Ga0123354_10000983 3300010882 Bacteria 32391
75 Ga0466690_028352 3300042590 Bacteria 80670
76 Ga0466691_080972 3300042593 Unclassified 3304
77 Ga0466696_010826 3300042596 Bacteria 7115
78 Ga0466696_182806 3300042596 Bacteria 2047
79 Ga0466705_433130 3300042612 Bacteria 4994
80 Ga0466710_103258 3300042613 Bacteria 3068
81 Ga0466710_345301 3300042613 Bacteria 3805
82 Ga0466715_290683 3300042616 Bacteria 15704
83 Ga0466723_089196 3300042618 Bacteria 18489
84 Ga0466726_204733 3300042619 Bacteria 56318
85 Ga0466726_427161 3300042619 Bacteria 8003
86 Ga0466729_035239 3300042621 Bacteria 10551
87 Ga0466729_069425 3300042621 Bacteria 2762
88 Ga0466729_172146 3300042621 Bacteria 14253
89 Ga0466735_038689 3300042624 Bacteria 6088
90 Ga0466735_044980 3300042624 Bacteria 12666
91 Ga0466704_118656 3300042643 Bacteria 31508
92 Ga0466704_500009 3300042643 Bacteria 11355
93 Ga0466716_152005 3300042605 Unclassified 19700
94 Ga0466719_126414 3300042606 Bacteria 59815
95 Ga0466705_056405 3300042612 Bacteria 35525
96 2227507960 2225789004 Bacteria 65507
97 JGI24700J35501_10930822 3300002508 Bacteria 25681
98 Ga0123357_10050950 3300009784 Bacteria 5601
99 Ga0123356_10010953 3300010049 Bacteria 8857
100 Ga0123353_10160975 3300010167 Bacteria 3574
101 Ga0123353_10303892 3300010167 Bacteria 2433
102 Ga0466696_023019 3300042596 Bacteria 39682
103 Ga0466696_057770 3300042596 Bacteria 5102
104 Ga0466696_274137 3300042596 Bacteria 12935
105 Ga0466711_000452 3300042615 Bacteria 9573
106 Ga0466723_066971 3300042618 Bacteria 14746
107 Ga0466726_380593 3300042619 Bacteria 10291
108 Ga0466729_024583 3300042621 Bacteria 11953
109 Ga0466735_014424 3300042624 Bacteria 8132
110 Ga0466735_135516 3300042624 Bacteria 5184
111 Ga0466735_156733 3300042624 Bacteria 12015
112 Ga0466703_293627 3300042636 Bacteria 11314
113 Ga0466703_427775 3300042636 Bacteria 5767
114 Ga0466704_161941 3300042643 Unclassified 5966
115 Ga0466704_235621 3300042643 Bacteria 3839
116 Ga0466724_39605 3300042649 Bacteria 6681
117 Ga0466727_168534 3300042655 Bacteria 69590
118 Ga0466706_099491 3300042599 Bacteria 6177
119 Ga0466713_046830 3300042602 Bacteria 25753
120 Ga0466719_082398 3300042606 Bacteria 66540
121 Ga0466719_123356 3300042606 Bacteria 12323
122 Ga0466719_390852 3300042606 Bacteria 7838
123 Ga0466705_008734 3300042612 Bacteria 11580
124 Ga0466705_103331 3300042612 Bacteria 16520
125 Ga0466705_356913 3300042612 Bacteria 3288
126 Ga0466733_074451 3300042659 Bacteria 9367
127 Ga0068302_10000977 3300005071 Bacteria 9169
128 Ga0068305_10000168 3300005083 Bacteria 304006
129 Ga0068305_10000199 3300005083 Bacteria 31184
130 Ga0123353_10157294 3300010167 Bacteria 3621
131 Ga0466696_051701 3300042596 Bacteria 27273
132 Ga0466705_411523 3300042612 Unclassified 12832
133 Ga0466710_161636 3300042613 Bacteria 7116
134 Ga0466711_158137 3300042615 Bacteria 13654
135 Ga0466715_025789 3300042616 Bacteria 20839
136 Ga0466723_154775 3300042618 Bacteria 5858
137 Ga0466726_487075 3300042619 Bacteria 5841
138 Ga0466734_010610 3300042623 Bacteria 1315
139 Ga0466735_064133 3300042624 Bacteria 6460
140 Ga0466735_075487 3300042624 Bacteria 4740
141 Ga0466704_211059 3300042643 Bacteria 5284
142 Ga0466708_152802 3300042652 Bacteria 15293
143 Ga0466707_134944 3300042601 Bacteria 69379
144 Ga0466707_311805 3300042601 Bacteria 94534
145 Ga0466716_375751 3300042605 Bacteria 18171
146 Ga0466716_399537 3300042605 Bacteria 33567
147 Ga0466719_406456 3300042606 Bacteria 24965
148 Ga0466705_345143 3300042612 Bacteria 11010
149 IMNBL1DRAFT_c0000004 3300000062 Bacteria 271062
150 IMNBL1DRAFT_c0000266 3300000062 Bacteria 46407
151 Ga0068302_10003923 3300005071 Bacteria 3686
152 Ga0123355_10000291 3300009826 Bacteria 64274
153 Ga0466690_030066 3300042590 Bacteria 3772
154 Ga0466710_062518 3300042613 Bacteria 24201
155 Ga0466711_040848 3300042615 Bacteria 4432
156 Ga0466711_064092 3300042615 Bacteria 13272
157 Ga0466711_188252 3300042615 Bacteria 2070
158 Ga0466711_195401 3300042615 Bacteria 76164
159 Ga0466718_103741 3300042617 Bacteria 1825
160 Ga0466728_096721 3300042620 Bacteria 4475
161 Ga0466731_385872 3300042622 Bacteria 10823
162 Ga0466735_155568 3300042624 Bacteria 10836
163 Ga0466702_177812 3300042635 Bacteria 4368
164 Ga0466708_022299 3300042652 Bacteria 12225
165 Ga0466708_216009 3300042652 Bacteria 21790
166 Ga0466727_257139 3300042655 Bacteria 56896
167 Ga0466707_165955 3300042601 Bacteria 16175
168 Ga0466716_322063 3300042605 Bacteria 4151
169 Ga0466716_531600 3300042605 Bacteria 5934
170 Ga0466721_030895 3300042608 Bacteria 26362
171 Ga0466705_081765 3300042612 Bacteria 5773
172 JGI24705J35276_12238803 3300002504 Bacteria 105587
173 Ga0068305_10000202 3300005083 Unclassified 76171
174 Ga0466695_067127 3300042595 Bacteria 4306
175 Ga0466711_330587 3300042615 Bacteria 18688
176 Ga0466711_466674 3300042615 Bacteria 3858
177 Ga0466715_098538 3300042616 Bacteria 131452
178 Ga0466715_241885 3300042616 Bacteria 16617
179 Ga0466723_010927 3300042618 Bacteria 7641
180 Ga0466723_141698 3300042618 Bacteria 266684
181 Ga0466723_150222 3300042618 Bacteria 7036
182 Ga0466726_090172 3300042619 Bacteria 28317
183 Ga0466729_186788 3300042621 Bacteria 1818
184 Ga0466702_318246 3300042635 Bacteria 3299
185 Ga0466703_156774 3300042636 Bacteria 6030
186 Ga0466704_058830 3300042643 Bacteria 7462
187 Ga0466704_219316 3300042643 Bacteria 28495
188 Ga0466704_372275 3300042643 Bacteria 54897
189 Ga0466704_375609 3300042643 Bacteria 17453
190 Ga0466727_277996 3300042655 Bacteria 60667
191 Ga0466727_332717 3300042655 Unclassified 8069
192 Ga0466706_049354 3300042599 Bacteria 18139
193 Ga0466706_177520 3300042599 Bacteria 18605
194 Ga0466706_214139 3300042599 Bacteria 2273
195 Ga0466707_121963 3300042601 Bacteria 17852
196 Ga0466719_325729 3300042606 Bacteria 8869
197 Ga0466719_524336 3300042606 Bacteria 382683

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042635 Ga0466702_198772 Ga0466702_198772_922_2055 343
2 iso_pr_bacteria 2978778678 2978779019 357
3 3300042618 Ga0466723_046729 Ga0466723_046729_189_1265 358
4 3300042643 Ga0466704_219316 Ga0466704_219316_23502_24653 358
5 3300042606 Ga0466719_406456 Ga0466719_406456_16502_17662 363
6 iso_pr_bacteria 2772190894 2773440164 363
7 3300042601 Ga0466707_134944 Ga0466707_134944_54538_55695 367
8 3300042621 Ga0466729_024583 Ga0466729_024583_373_1530 367
9 3300042636 Ga0466703_250320 Ga0466703_250320_389876_391027 367
10 3300010049 Ga0123356_10000001 Ga0123356_1000000133 368
11 3300042599 Ga0466706_099491 Ga0466706_099491_918_2081 368
12 3300042620 Ga0466728_250626 Ga0466728_250626_12583_13752 370
13 3300042643 Ga0466704_161941 Ga0466704_161941_1802_2971 370
14 3300010049 Ga0123356_10014972 Ga0123356_100149724 371
15 3300042615 Ga0466711_466674 Ga0466711_466674_1343_2503 372
16 3300010882 Ga0123354_10000983 Ga0123354_1000098315 373
17 3300042601 Ga0466707_344506 Ga0466707_344506_860_2029 375
18 3300042615 Ga0466711_195401 Ga0466711_195401_58438_59598 376
19 3300042601 Ga0466707_165955 Ga0466707_165955_2994_4127 377
20 3300042606 Ga0466719_123356 Ga0466719_123356_2938_4116 377
21 3300042613 Ga0466710_062518 Ga0466710_062518_16610_17806 377
22 3300042618 Ga0466723_010927 Ga0466723_010927_5443_6576 377
23 3300042602 Ga0466713_087792 Ga0466713_087792_1990_3126 378
24 3300042606 Ga0466719_390852 Ga0466719_390852_996_2132 378
25 3300042612 Ga0466705_103331 Ga0466705_103331_10642_11811 378
26 3300042615 Ga0466711_188252 Ga0466711_188252_48_1259 378
27 3300042622 Ga0466731_385872 Ga0466731_385872_8837_9973 378
28 3300042635 Ga0466702_104040 Ga0466702_104040_1346_2482 378
29 3300042635 Ga0466702_177812 Ga0466702_177812_3132_4268 378
30 3300042635 Ga0466702_318246 Ga0466702_318246_1002_2138 378
31 3300042636 Ga0466703_293627 Ga0466703_293627_3680_4816 378
32 2225789003 2227041496 2227401375 380
33 3300042594 Ga0466694_099253 Ga0466694_099253_162_1304 380
34 3300042597 Ga0466699_309712 Ga0466699_309712_11_1153 380
35 3300042608 Ga0466721_030895 Ga0466721_030895_9174_10316 380
36 3300042652 Ga0466708_236624 Ga0466708_236624_1821_2963 380
37 iso_pr_bacteria 2864773010 2864773360 380
38 iso_pr_bacteria 2864918810 2864920745 380
39 iso_pr_bacteria 2864964650 2864965000 380
40 iso_pr_bacteria 646564587 646804505 380
41 iso_pr_bacteria 8073539042 8073539388 380
42 iso_pr_bacteria 8077775691 8077777588 380
43 3300000062 IMNBL1DRAFT_c0000004 IMNBL1DRAFT_000000432 381
44 3300042612 Ga0466705_152901 Ga0466705_152901_7675_8904 381
45 3300042621 Ga0466729_018474 Ga0466729_018474_7720_8865 381
46 2225789004 2227461360 2227896422 382
47 3300042602 Ga0466713_079335 Ga0466713_079335_54929_56077 382
48 3300042619 Ga0466726_380593 Ga0466726_380593_5244_6392 382
49 3300042624 Ga0466735_155568 Ga0466735_155568_4565_5713 382
50 3300042659 Ga0466733_018838 Ga0466733_018838_262_1410 382
51 3300042659 Ga0466733_074451 Ga0466733_074451_6373_7521 382
52 iso_pr_bacteria 2529293168 2531451534 382
53 iso_pr_bacteria 8030343600 8030346125 382
54 3300000062 IMNBL1DRAFT_c0000266 IMNBL1DRAFT_000026632 383
55 3300005083 Ga0068305_10000168 Ga0068305_1000016898 383
56 3300042596 Ga0466696_023019 Ga0466696_023019_20454_21605 383
57 3300042606 Ga0466719_524336 Ga0466719_524336_243863_245014 383
58 3300042612 Ga0466705_345143 Ga0466705_345143_1047_2198 383
59 3300042615 Ga0466711_330587 Ga0466711_330587_13487_14638 383
60 3300042616 Ga0466715_098538 Ga0466715_098538_76130_77281 383
61 3300042618 Ga0466723_150222 Ga0466723_150222_277_1428 383
62 3300042618 Ga0466723_154775 Ga0466723_154775_4404_5555 383
63 3300042636 Ga0466703_156774 Ga0466703_156774_3159_4310 383
64 3300042636 Ga0466703_271965 Ga0466703_271965_3894_5045 383
65 3300042655 Ga0466727_332717 Ga0466727_332717_1054_2205 383
66 iso_pr_bacteria 2820671341 2820672583 383
67 3300002450 JGI24695J34938_10004084 JGI24695J34938_100040847 384
68 3300042596 Ga0466696_051701 Ga0466696_051701_17996_19150 384
69 3300042596 Ga0466696_070358 Ga0466696_070358_94_1248 384
70 3300042601 Ga0466707_111198 Ga0466707_111198_24460_25614 384
71 3300042652 Ga0466708_216009 Ga0466708_216009_19755_20909 384
72 iso_pr_bacteria 2820547636 2820548511 384
73 iso_pr_bacteria 2820647881 2820651475 384
74 3300042601 Ga0466707_311805 Ga0466707_311805_63445_64602 385
75 3300042612 Ga0466705_081765 Ga0466705_081765_2289_3494 385
76 3300042624 Ga0466735_002449 Ga0466735_002449_4661_5818 385
77 3300042624 Ga0466735_014424 Ga0466735_014424_2336_3493 385
78 3300042624 Ga0466735_038689 Ga0466735_038689_2196_3353 385
79 3300042624 Ga0466735_044980 Ga0466735_044980_841_1998 385
80 3300042624 Ga0466735_064133 Ga0466735_064133_2940_4097 385
81 3300042624 Ga0466735_075487 Ga0466735_075487_1238_2395 385
82 3300042624 Ga0466735_134648 Ga0466735_134648_817_1974 385
83 3300042624 Ga0466735_135516 Ga0466735_135516_3347_4504 385
84 3300042624 Ga0466735_156733 Ga0466735_156733_9151_10308 385
85 3300042652 Ga0466708_152802 Ga0466708_152802_10909_12066 385
86 iso_pr_bacteria 2537562000 2539435189 385
87 iso_pr_bacteria 2563367190 2565789320 385
88 iso_pr_bacteria 2822232166 2822235988 385
89 iso_pr_bacteria 2822450720 2822452915 385
90 iso_pr_bacteria 2864782175 2864785385 385
91 iso_pr_bacteria 2912849059 2912852405 385
92 iso_pr_bacteria 2969145278 2969149231 385
93 iso_pr_bacteria 642555172 642791195 385
94 iso_pr_bacteria 643886085 644680630 385
95 iso_pr_bacteria 643886087 644668374 385
96 iso_pr_bacteria 643886090 644662264 385
97 iso_pr_bacteria 643886091 644649305 385
98 iso_pr_bacteria 8022725327 8022729228 385
99 iso_pr_bacteria 8022781829 8022782704 385
100 iso_pr_bacteria 8061039349 8061042542 385
101 iso_pr_bacteria 8061045771 8061046341 385
102 iso_pr_bacteria 8061100935 8061106064 385
103 2225789004 2227507960 2227998855 386
104 3300003973 Ga0063521_1005672 Ga0063521_10056721 386
105 3300026558 Ga0255576_1000001 Ga0255576_1000001195 386
106 3300042593 Ga0466691_017171 Ga0466691_017171_15705_16865 386
107 3300042596 Ga0466696_010826 Ga0466696_010826_5899_7059 386
108 3300042599 Ga0466706_049354 Ga0466706_049354_3994_5154 386
109 3300042599 Ga0466706_177520 Ga0466706_177520_14585_15745 386
110 3300042601 Ga0466707_121963 Ga0466707_121963_1529_2689 386
111 3300042602 Ga0466713_046830 Ga0466713_046830_5520_6680 386
112 3300042602 Ga0466713_077401 Ga0466713_077401_1610_2770 386
113 3300042602 Ga0466713_110936 Ga0466713_110936_12742_13902 386
114 3300042613 Ga0466710_161636 Ga0466710_161636_3605_4765 386
115 3300042616 Ga0466715_290683 Ga0466715_290683_6193_7353 386
116 3300042619 Ga0466726_427161 Ga0466726_427161_5433_6593 386
117 3300042620 Ga0466728_096721 Ga0466728_096721_1741_2901 386
118 3300042621 Ga0466729_035239 Ga0466729_035239_4288_5448 386
119 3300042621 Ga0466729_065558 Ga0466729_065558_1121_2281 386
120 3300042621 Ga0466729_069425 Ga0466729_069425_387_1547 386
121 3300042655 Ga0466727_257139 Ga0466727_257139_30847_32007 386
122 3300042655 Ga0466727_347688 Ga0466727_347688_1087_2247 386
123 3300000062 IMNBL1DRAFT_c0000440 IMNBL1DRAFT_00004404 387
124 3300000062 IMNBL1DRAFT_c0008974 IMNBL1DRAFT_00089744 387
125 3300005071 Ga0068302_10003016 Ga0068302_100030168 387
126 3300005071 Ga0068302_10003017 Ga0068302_1000301712 387
127 3300005083 Ga0068305_10000199 Ga0068305_1000019914 387
128 3300005083 Ga0068305_10000200 Ga0068305_1000020042 387
129 3300010049 Ga0123356_10010953 Ga0123356_100109538 387
130 3300010167 Ga0123353_10012731 Ga0123353_100127317 387
131 3300010167 Ga0123353_10303892 Ga0123353_103038922 387
132 3300042605 Ga0466716_531600 Ga0466716_531600_4576_5739 387
133 3300042615 Ga0466711_158137 Ga0466711_158137_11583_12746 387
134 3300042619 Ga0466726_047931 Ga0466726_047931_64734_65897 387
135 3300042621 Ga0466729_117205 Ga0466729_117205_39400_40563 387
136 3300042648 Ga0466709_146781 Ga0466709_146781_18941_20104 387
137 iso_pr_bacteria 2772190893 2773437969 387
138 3300009784 Ga0123357_10050950 Ga0123357_100509503 388
139 3300042590 Ga0466690_028352 Ga0466690_028352_58999_60165 388
140 3300042590 Ga0466690_030066 Ga0466690_030066_1688_2854 388
141 3300042590 Ga0466690_032452 Ga0466690_032452_1629_2795 388
142 3300042590 Ga0466690_313401 Ga0466690_313401_30105_31271 388
143 3300042593 Ga0466691_080972 Ga0466691_080972_1282_2448 388
144 3300042596 Ga0466696_182806 Ga0466696_182806_342_1508 388
145 3300042596 Ga0466696_274137 Ga0466696_274137_2153_3319 388
146 3300042603 Ga0466714_112063 Ga0466714_112063_24988_26154 388
147 3300042605 Ga0466716_152005 Ga0466716_152005_3025_4191 388
148 3300042605 Ga0466716_236915 Ga0466716_236915_3025_4191 388
149 3300042605 Ga0466716_399537 Ga0466716_399537_19996_21162 388
150 3300042606 Ga0466719_082398 Ga0466719_082398_45025_46191 388
151 3300042609 Ga0466722_024175 Ga0466722_024175_1338_2504 388
152 3300042612 Ga0466705_056405 Ga0466705_056405_17536_18702 388
153 3300042612 Ga0466705_321631 Ga0466705_321631_166792_167958 388
154 3300042612 Ga0466705_411523 Ga0466705_411523_9319_10485 388
155 3300042612 Ga0466705_433130 Ga0466705_433130_1390_2556 388
156 3300042612 Ga0466705_471806 Ga0466705_471806_5216_6382 388
157 3300042615 Ga0466711_134125 Ga0466711_134125_87490_88656 388
158 3300042616 Ga0466715_025789 Ga0466715_025789_11141_12307 388
159 3300042616 Ga0466715_063048 Ga0466715_063048_19335_20501 388
160 3300042618 Ga0466723_020100 Ga0466723_020100_7783_8949 388
161 3300042618 Ga0466723_029076 Ga0466723_029076_3018_4184 388
162 3300042618 Ga0466723_141698 Ga0466723_141698_230891_232057 388
163 3300042619 Ga0466726_090172 Ga0466726_090172_19852_21018 388
164 3300042623 Ga0466734_010610 Ga0466734_010610_20_1186 388
165 3300042636 Ga0466703_131108 Ga0466703_131108_13762_14928 388
166 3300042643 Ga0466704_012048 Ga0466704_012048_54753_55919 388
167 3300042643 Ga0466704_118656 Ga0466704_118656_19994_21160 388
168 3300042643 Ga0466704_211059 Ga0466704_211059_754_1920 388
169 3300042643 Ga0466704_235621 Ga0466704_235621_324_1490 388
170 3300042643 Ga0466704_336061 Ga0466704_336061_2713_3879 388
171 3300042643 Ga0466704_375609 Ga0466704_375609_14935_16101 388
172 3300042655 Ga0466727_277996 Ga0466727_277996_51061_52227 388
173 iso_pr_bacteria 2754412482 2755214778 388
174 iso_pr_bacteria 2754412483 2755216864 388
175 3300005071 Ga0068302_10000977 Ga0068302_100009778 389
176 3300005083 Ga0068305_10000202 Ga0068305_1000020261 389
177 3300042605 Ga0466716_375751 Ga0466716_375751_4715_5884 389
178 3300042616 Ga0466715_241885 Ga0466715_241885_10772_11941 389
179 3300042618 Ga0466723_241706 Ga0466723_241706_4690_5859 389
180 3300042619 Ga0466726_065940 Ga0466726_065940_143824_144993 389
181 3300042619 Ga0466726_217236 Ga0466726_217236_69813_70982 389
182 3300042619 Ga0466726_487075 Ga0466726_487075_1699_2868 389
183 3300042649 Ga0466724_39605 Ga0466724_39605_3071_4240 389
184 3300005071 Ga0068302_10003923 Ga0068302_100039233 390
185 3300042609 Ga0466722_202598 Ga0466722_202598_57_1229 390
186 3300042643 Ga0466704_372275 Ga0466704_372275_52994_54166 390
187 3300042643 Ga0466704_500009 Ga0466704_500009_4340_5512 390
188 3300042636 Ga0466703_297371 Ga0466703_297371_9380_10555 391
189 3300042654 Ga0466725_043029 Ga0466725_043029_2674_3849 391
190 3300042606 Ga0466719_126414 Ga0466719_126414_51342_52520 392
191 3300042612 Ga0466705_275974 Ga0466705_275974_4577_5755 392
192 3300042612 Ga0466705_467619 Ga0466705_467619_31_1209 392
193 3300042618 Ga0466723_089196 Ga0466723_089196_10617_11795 392
194 3300042624 Ga0466735_029069 Ga0466735_029069_32858_34036 392
195 3300042615 Ga0466711_000452 Ga0466711_000452_5552_6733 393
196 3300042619 Ga0466726_204733 Ga0466726_204733_12027_13208 393
197 3300042655 Ga0466727_168534 Ga0466727_168534_24809_25993 394
198 3300042655 Ga0466727_172156 Ga0466727_172156_111653_112837 394
199 iso_pr_bacteria 2820306284 2820309078 394
200 3300002508 JGI24700J35501_10930822 JGI24700J35501_1093082218 395
201 3300042612 Ga0466705_356913 Ga0466705_356913_1470_2657 395
202 3300042613 Ga0466710_103258 Ga0466710_103258_710_1897 395
203 3300002504 JGI24705J35276_12238803 JGI24705J35276_1223880339 396
204 3300010167 Ga0123353_10003195 Ga0123353_100031951 396
205 3300010049 Ga0123356_10091749 Ga0123356_100917493 397
206 3300042599 Ga0466706_214139 Ga0466706_214139_889_2085 398
207 3300042612 Ga0466705_377825 Ga0466705_377825_11564_12760 398
208 iso_pr_bacteria 2864808494 2864812185 398
209 iso_pr_bacteria 2864812326 2864816004 398
210 3300042613 Ga0466710_345301 Ga0466710_345301_2523_3722 399
211 iso_pr_bacteria 2820617402 2820618124 400
212 3300009826 Ga0123355_10000291 Ga0123355_1000029153 401
213 3300042594 Ga0466694_154038 Ga0466694_154038_915_2120 401
214 iso_pr_bacteria 2820347164 2820348927 401
215 3300010049 Ga0123356_10099014 Ga0123356_100990142 402
216 iso_pr_bacteria 2820238527 2820240105 403
217 3300042617 Ga0466718_103741 Ga0466718_103741_275_1495 406
218 3300042591 Ga0466692_129576 Ga0466692_129576_5287_6513 408
219 3300042595 Ga0466695_067127 Ga0466695_067127_1120_2346 408
220 3300042621 Ga0466729_172146 Ga0466729_172146_12377_13615 412
221 3300010167 Ga0123353_10157294 Ga0123353_101572941 415
222 3300010167 Ga0123353_10160975 Ga0123353_101609752 416
223 3300042615 Ga0466711_270096 Ga0466711_270096_152_1663 417
224 iso_pr_bacteria 2820171952 2820176049 420
225 3300056856 Ga0562375_0863 Ga0562375_0863_27048_28358 422
226 3300042621 Ga0466729_186788 Ga0466729_186788_100_1377 425
227 3300042643 Ga0466704_058830 Ga0466704_058830_6168_7445 425
228 iso_pr_bacteria 2820205024 2820205900 425
229 3300042652 Ga0466708_022299 Ga0466708_022299_10126_11478 429
230 3300042636 Ga0466703_427775 Ga0466703_427775_390_1694 434
231 3300042616 Ga0466715_114009 Ga0466715_114009_11344_12744 435
232 3300042605 Ga0466716_322063 Ga0466716_322063_11_1492 436
233 3300042596 Ga0466696_057770 Ga0466696_057770_887_2245 441
234 3300042612 Ga0466705_008734 Ga0466705_008734_7914_9248 444
235 3300042615 Ga0466711_040848 Ga0466711_040848_1272_2705 448
236 3300042618 Ga0466723_066971 Ga0466723_066971_9859_11259 449
237 3300042615 Ga0466711_064092 Ga0466711_064092_4709_6142 458
238 3300042606 Ga0466719_325729 Ga0466719_325729_3197_4579 460

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13288 DXPR_C DXP reductoisomerase C-terminal domain 336 452 0.98
PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain 230 304 0.89
PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase 11 64 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08436 GO:0005515 protein binding MF
PF02670 GO:0070402 NADPH binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.