Protein Family IF06553

Metagenome Isolate
126 Members
59 Samples
108 Scaffolds
238.12 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_319926|Ga0466719_319926_475_1284
Length
269 aa
Sequence
LLLSGLSVYHFRHVCYNIGMSETSLITCIGTSFGYDGAPVIRGLDFSVEAGDYLCVIGENGSGKTTLVKGLLRLLPPLEGTISFNNGIKQNEIGFLSQQAAAKKDFPASVYEIVLTGNVGSMGMRPFYTKREKAKAEEYLELLGIAGLRNRAFRELSGGEQRRALLARALCAYRKLLVLDEPTAGLDPLATDAVYMLLEKINRERAIPIVMVSHDMKVAAAYANRILHVFHKQLFFGSPEAFIHTDTGKQFFKASEGAKRGGNLSGNAD

πŸ“Š Sample Types

Isolate 14.3%
Metagenome 85.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 32.8%
Termitidae 27.6%
Kalotermitidae 22.4%
Rhinotermitidae 5.2%
Passalidae 5.2%
Termopsidae 3.4%
Stratiomyidae 1.7%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 6

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
4 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
14 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
22 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
23 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
24 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
31 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
32 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
33 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
35 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
36 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
37 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 2778260939 Unclassified Fibrobacteres Co191P4bin13 Isolate Unclassified
43 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
44 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
45 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
50 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
51 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
52 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
53 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
54 2773857779 Unclassified Fibrobacteres Co191P1bin69 Isolate Unclassified
55 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
56 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
57 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
58 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
59 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_161209 3300042612 Bacteria 9064
2 Ga0466690_236591 3300042590 Bacteria 2396
3 Ga0466729_054557 3300042621 Bacteria 65127
4 Ga0123353_10035825 3300010167 Bacteria 7765
5 Ga0466703_329569 3300042636 Bacteria 22009
6 Ga0466704_504183 3300042643 Bacteria 2855
7 Ga0466706_088877 3300042599 Bacteria 3951
8 Ga0466707_033588 3300042601 Bacteria 5507
9 IMNBL1DRAFT_c0000613 3300000062 Unclassified 28606
10 JGI24703J35330_11748466 3300002501 Bacteria 17016
11 Ga0466715_376847 3300042616 Bacteria 10857
12 Ga0466726_055790 3300042619 Bacteria 1607
13 Ga0466728_152445 3300042620 Bacteria 15267
14 Ga0123355_10091707 3300009826 Bacteria 4816
15 Ga0466735_117864 3300042624 Bacteria 3102
16 Ga0466704_175727 3300042643 Bacteria 18216
17 Ga0466713_096000 3300042602 Bacteria 3340
18 Ga0466722_247725 3300042609 Bacteria 19598
19 Ga0466698_359814 3300042610 Bacteria 1365
20 Ga0466705_364970 3300042612 Bacteria 18969
21 JGI24695J34938_10000169 3300002450 Bacteria 61182
22 JGI24700J35501_10930738 3300002508 Bacteria 21095
23 Ga0415639_152818 3300038395 Bacteria 4344
24 Ga0466696_069498 3300042596 Bacteria 1214
25 Ga0466711_047506 3300042615 Bacteria 5612
26 Ga0123355_10007449 3300009826 Bacteria 16398
27 Ga0123355_10633568 3300009826 Bacteria 1255
28 Ga0123356_10013721 3300010049 Bacteria 7805
29 Ga0123356_11276187 3300010049 Bacteria 898
30 Ga0123353_10034077 3300010167 Unclassified 7940
31 Ga0466725_463602 3300042654 Bacteria 3743
32 Ga0466706_148334 3300042599 Bacteria 4983
33 Ga0466714_047757 3300042603 Bacteria 59393
34 Ga0466717_253296 3300042604 Bacteria 1537
35 2227253045 2225789004 Bacteria 1315
36 2227463518 2225789004 Bacteria 25639
37 JGI24695J34938_10000961 3300002450 Bacteria 26250
38 JGI24703J35330_11748443 3300002501 Bacteria 16340
39 Ga0466692_175087 3300042591 Bacteria 69588
40 Ga0466696_154335 3300042596 Bacteria 1716
41 Ga0466705_507731 3300042612 Bacteria 1550
42 Ga0466726_179791 3300042619 Bacteria 6243
43 Ga0123355_10000779 3300009826 Bacteria 43586
44 Ga0123355_10319701 3300009826 Bacteria 2093
45 Ga0123355_10731020 3300009826 Bacteria 1126
46 Ga0123356_10136895 3300010049 Unclassified 2409
47 Ga0466703_356545 3300042636 Bacteria 14158
48 Ga0466700_290671 3300042600 Bacteria 1205
49 Ga0466707_333846 3300042601 Bacteria 2092
50 Ga0466714_043816 3300042603 Bacteria 12131
51 Ga0466714_045139 3300042603 Bacteria 7892
52 Ga0466722_236644 3300042609 Bacteria 37557
53 Ga0466733_012154 3300042659 Bacteria 1641
54 IMNBL1DRAFT_c0020127 3300000062 Bacteria 2712
55 Ga0466691_022745 3300042593 Bacteria 2255
56 Ga0466705_435295 3300042612 Bacteria 1122
57 Ga0123355_10128010 3300009826 Bacteria 3919
58 Ga0123355_10604457 3300009826 Bacteria 1300
59 Ga0123355_10917803 3300009826 Bacteria 947
60 Ga0123353_10103351 3300010167 Bacteria 4593
61 Ga0466703_294924 3300042636 Bacteria 10266
62 Ga0466704_201318 3300042643 Bacteria 3350
63 Ga0466719_319926 3300042606 Unclassified 1599
64 Ga0466722_011289 3300042609 Bacteria 3614
65 2226991791 2225789003 Bacteria 1542
66 IMNBL1DRAFT_c0000123 3300000062 Bacteria 69107
67 IMNBL1DRAFT_c0027800 3300000062 Bacteria 2120
68 JGI24695J34938_10141734 3300002450 Bacteria 982
69 JGI24696J40584_12961313 3300002834 Bacteria 13489
70 Ga0466694_249725 3300042594 Bacteria 1176
71 Ga0466715_283467 3300042616 Bacteria 11813
72 Ga0123355_10216120 3300009826 Bacteria 2767
73 Ga0123353_10326191 3300010167 Bacteria 2327
74 Ga0123353_10967728 3300010167 Bacteria 1149
75 Ga0466703_093322 3300042636 Bacteria 5741
76 Ga0466704_325262 3300042643 Bacteria 2387
77 Ga0466706_143680 3300042599 Bacteria 6288
78 Ga0466705_362345 3300042612 Bacteria 14151
79 Ga0072941_1726977 3300005201 Bacteria 963
80 Ga0415639_042470 3300038395 Bacteria 3500
81 Ga0415639_138663 3300038395 Unclassified 1354
82 Ga0466723_015284 3300042618 Bacteria 6559
83 Ga0466723_089320 3300042618 Bacteria 5868
84 Ga0123355_10083122 3300009826 Bacteria 5105
85 Ga0123356_10637712 3300010049 Bacteria 1232
86 Ga0123353_11701444 3300010167 Bacteria 790
87 Ga0466704_551369 3300042643 Unclassified 1193
88 Ga0466707_066307 3300042601 Bacteria 1351
89 Ga0466707_085508 3300042601 Bacteria 5032
90 Ga0466707_291467 3300042601 Bacteria 1227
91 Ga0466716_099499 3300042605 Bacteria 5339
92 Ga0466705_224088 3300042612 Bacteria 21237
93 JGI24695J34938_10005728 3300002450 Bacteria 7662
94 Ga0415639_018951 3300038395 Bacteria 2516
95 Ga0466690_387403 3300042590 Bacteria 4774
96 Ga0466690_406119 3300042590 Bacteria 1009
97 Ga0466693_131997 3300042592 Bacteria 1382
98 Ga0466726_139332 3300042619 Bacteria 5465
99 Ga0123355_10416923 3300009826 Bacteria 1719
100 Ga0123353_10130045 3300010167 Bacteria 4042
101 Ga0466703_071012 3300042636 Bacteria 7493
102 Ga0466704_299675 3300042643 Bacteria 5898
103 Ga0466708_086288 3300042652 Bacteria 2976
104 Ga0466706_102022 3300042599 Bacteria 9877
105 Ga0466719_071968 3300042606 Bacteria 1043
106 Ga0466719_206218 3300042606 Bacteria 3548
107 Ga0466719_546536 3300042606 Bacteria 3031
108 Ga0466722_120203 3300042609 Bacteria 3379

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042594 Ga0466694_249725 Ga0466694_249725_213_839 208
2 3300010167 Ga0123353_11701444 Ga0123353_117014442 212
3 iso_pr_bacteria 2778260939 2778353741 214
4 3300002834 JGI24696J40584_12961313 JGI24696J40584_1296131310 215
5 3300042654 Ga0466725_463602 Ga0466725_463602_1286_2008 216
6 3300042602 Ga0466713_096000 Ga0466713_096000_1362_2024 220
7 iso_pr_bacteria 2778260941 2778359877 221
8 iso_pr_bacteria 2773857779 2774478023 222
9 iso_pr_bacteria 2778260937 2778347533 222
10 3300002450 JGI24695J34938_10000169 JGI24695J34938_100001694 223
11 3300002450 JGI24695J34938_10005728 JGI24695J34938_100057283 223
12 3300002450 JGI24695J34938_10141734 JGI24695J34938_101417342 223
13 3300042609 Ga0466722_247725 Ga0466722_247725_4222_4899 225
14 3300042643 Ga0466704_175727 Ga0466704_175727_2609_3292 227
15 3300042600 Ga0466700_290671 Ga0466700_290671_96_782 228
16 3300042612 Ga0466705_362345 Ga0466705_362345_4968_5696 230
17 iso_pr_bacteria 2820380671 2820381975 230
18 3300002501 JGI24703J35330_11748443 JGI24703J35330_1174844313 231
19 3300042599 Ga0466706_102022 Ga0466706_102022_4807_5505 232
20 3300042603 Ga0466714_045139 Ga0466714_045139_5025_5723 232
21 3300042643 Ga0466704_201318 Ga0466704_201318_2484_3182 232
22 3300042643 Ga0466704_551369 Ga0466704_551369_254_955 233
23 3300042590 Ga0466690_387403 Ga0466690_387403_2653_3357 234
24 3300042601 Ga0466707_033588 Ga0466707_033588_2858_3562 234
25 3300042601 Ga0466707_085508 Ga0466707_085508_2993_3697 234
26 iso_pr_bacteria 2820490862 2820491926 234
27 iso_pr_bacteria 8030337018 8030340051 234
28 3300000062 IMNBL1DRAFT_c0020127 IMNBL1DRAFT_00201271 235
29 3300042599 Ga0466706_088877 Ga0466706_088877_142_849 235
30 3300042599 Ga0466706_143680 Ga0466706_143680_2163_2870 235
31 3300042599 Ga0466706_148334 Ga0466706_148334_3827_4534 235
32 3300042601 Ga0466707_066307 Ga0466707_066307_166_873 235
33 3300042609 Ga0466722_120203 Ga0466722_120203_350_1057 235
34 3300042615 Ga0466711_047506 Ga0466711_047506_2116_2823 235
35 3300042621 Ga0466729_054557 Ga0466729_054557_34719_35426 235
36 iso_pr_bacteria 2820375548 2820377888 235
37 2225789003 2226991791 2227342255 236
38 2225789004 2227253045 2227696912 236
39 2225789004 2227463518 2227898772 236
40 3300002501 JGI24703J35330_11748466 JGI24703J35330_117484667 236
41 3300009826 Ga0123355_10731020 Ga0123355_107310202 236
42 3300010049 Ga0123356_10136895 Ga0123356_101368952 236
43 3300010167 Ga0123353_10103351 Ga0123353_101033514 236
44 3300038395 Ga0415639_042470 Ga0415639_042470_2029_2739 236
45 3300042610 Ga0466698_359814 Ga0466698_359814_177_887 236
46 3300042612 Ga0466705_161209 Ga0466705_161209_4073_4783 236
47 3300042636 Ga0466703_071012 Ga0466703_071012_4998_5708 236
48 3300042636 Ga0466703_329569 Ga0466703_329569_19163_19873 236
49 iso_pr_bacteria 2820357977 2820358291 236
50 iso_pr_bacteria 2820683647 2820685517 236
51 iso_pr_bacteria 2820693137 2820693373 236
52 3300000062 IMNBL1DRAFT_c0000613 IMNBL1DRAFT_000061324 237
53 3300000062 IMNBL1DRAFT_c0027800 IMNBL1DRAFT_00278003 237
54 3300009826 Ga0123355_10319701 Ga0123355_103197012 237
55 3300010167 Ga0123353_10130045 Ga0123353_101300452 237
56 3300042592 Ga0466693_131997 Ga0466693_131997_495_1208 237
57 3300042609 Ga0466722_236644 Ga0466722_236644_18896_19609 237
58 3300042619 Ga0466726_055790 Ga0466726_055790_74_787 237
59 3300042652 Ga0466708_086288 Ga0466708_086288_2016_2729 237
60 iso_pr_bacteria 2820522177 2820524755 237
61 3300002450 JGI24695J34938_10000961 JGI24695J34938_100009619 238
62 3300009826 Ga0123355_10083122 Ga0123355_100831222 238
63 3300038395 Ga0415639_018951 Ga0415639_018951_70_786 238
64 3300038395 Ga0415639_152818 Ga0415639_152818_2765_3481 238
65 3300042590 Ga0466690_406119 Ga0466690_406119_188_904 238
66 3300042603 Ga0466714_043816 Ga0466714_043816_8922_9638 238
67 3300042609 Ga0466722_011289 Ga0466722_011289_468_1184 238
68 iso_pr_bacteria 2820431532 2820431815 238
69 iso_pr_bacteria 2820472365 2820472462 238
70 3300009826 Ga0123355_10091707 Ga0123355_100917076 239
71 3300009826 Ga0123355_10216120 Ga0123355_102161204 239
72 3300009826 Ga0123355_10416923 Ga0123355_104169232 239
73 3300009826 Ga0123355_10633568 Ga0123355_106335682 239
74 3300009826 Ga0123355_10917803 Ga0123355_109178032 239
75 3300010049 Ga0123356_11276187 Ga0123356_112761871 239
76 3300010167 Ga0123353_10034077 Ga0123353_100340776 239
77 3300010167 Ga0123353_10035825 Ga0123353_100358254 239
78 3300009826 Ga0123355_10000779 Ga0123355_100007792 240
79 3300009826 Ga0123355_10007449 Ga0123355_1000744911 240
80 3300042591 Ga0466692_175087 Ga0466692_175087_922_1644 240
81 3300042604 Ga0466717_253296 Ga0466717_253296_217_939 240
82 3300042643 Ga0466704_504183 Ga0466704_504183_305_1027 240
83 iso_pr_bacteria 2819994798 2819997269 240
84 iso_pr_bacteria 2820332331 2820332336 240
85 iso_pr_bacteria 2820607737 2820609948 240
86 3300002508 JGI24700J35501_10930738 JGI24700J35501_1093073818 241
87 3300005201 Ga0072941_1726977 Ga0072941_17269772 241
88 3300009826 Ga0123355_10604457 Ga0123355_106044572 241
89 3300010049 Ga0123356_10013721 Ga0123356_100137217 241
90 3300010167 Ga0123353_10326191 Ga0123353_103261912 241
91 3300010167 Ga0123353_10967728 Ga0123353_109677282 241
92 3300038395 Ga0415639_138663 Ga0415639_138663_461_1186 241
93 3300042590 Ga0466690_236591 Ga0466690_236591_454_1179 241
94 3300042612 Ga0466705_364970 Ga0466705_364970_338_1063 241
95 3300042620 Ga0466728_152445 Ga0466728_152445_9275_10000 241
96 3300042636 Ga0466703_356545 Ga0466703_356545_1882_2607 241
97 3300042643 Ga0466704_299675 Ga0466704_299675_359_1084 241
98 3300042643 Ga0466704_325262 Ga0466704_325262_1428_2153 241
99 3300009826 Ga0123355_10128010 Ga0123355_101280102 242
100 3300042593 Ga0466691_022745 Ga0466691_022745_1008_1736 242
101 3300042603 Ga0466714_047757 Ga0466714_047757_2888_3616 242
102 3300042605 Ga0466716_099499 Ga0466716_099499_1181_1909 242
103 3300042606 Ga0466719_071968 Ga0466719_071968_199_927 242
104 3300042624 Ga0466735_117864 Ga0466735_117864_1611_2339 242
105 3300042596 Ga0466696_069498 Ga0466696_069498_418_1149 243
106 3300042596 Ga0466696_154335 Ga0466696_154335_757_1488 243
107 3300042612 Ga0466705_507731 Ga0466705_507731_383_1114 243
108 3300042618 Ga0466723_015284 Ga0466723_015284_3860_4591 243
109 3300042619 Ga0466726_179791 Ga0466726_179791_3777_4508 243
110 3300042619 Ga0466726_139332 Ga0466726_139332_3515_4249 244
111 3300042601 Ga0466707_291467 Ga0466707_291467_116_853 245
112 3300042601 Ga0466707_333846 Ga0466707_333846_393_1130 245
113 3300042616 Ga0466715_376847 Ga0466715_376847_9822_10559 245
114 3300042636 Ga0466703_294924 Ga0466703_294924_753_1508 245
115 3300042606 Ga0466719_206218 Ga0466719_206218_2433_3173 246
116 3300042618 Ga0466723_089320 Ga0466723_089320_268_1008 246
117 3300042659 Ga0466733_012154 Ga0466733_012154_257_1159 246
118 3300042612 Ga0466705_435295 Ga0466705_435295_362_1105 247
119 3300042616 Ga0466715_283467 Ga0466715_283467_1632_2375 247
120 3300042606 Ga0466719_546536 Ga0466719_546536_254_1003 249
121 3300000062 IMNBL1DRAFT_c0000123 IMNBL1DRAFT_000012338 253
122 3300010049 Ga0123356_10637712 Ga0123356_106377122 253
123 iso_pr_bacteria 2781125630 2781266297 258
124 3300042606 Ga0466719_319926 Ga0466719_319926_475_1284 269
125 3300042612 Ga0466705_224088 Ga0466705_224088_2868_3788 306
126 3300042636 Ga0466703_093322 Ga0466703_093322_1127_2053 308

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 42 184 0.88
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 147 216 0.88
PF02463 SMC_N RecF/RecN/SMC N terminal domain 55 231 0.72

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.