Protein Family IF06518

Metagenome Isolate
121 Members
45 Samples
118 Scaffolds
244.45 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_205335|Ga0466719_205335_488_1345
Length
285 aa
Sequence
MQIYNIFWFYTKLSTGTLCLTFAIFVVYLRTKQKEMNSILFCLVEEKRLGRKGGLYHKTQVNLAYNSNRIEGSRLTEEQTRYIFETRTIGFKEEEAVPVDDIIETSNHFVALDYLIDTIDTPLSNELIRTLHRILKTGTADAAKSWFPVGDWKKLPNEVGGSATTLPRDVEKEMNQLNDWYLHTTIFSLDKIIEYHYRFEKIHPFQDGNGRVGRLIMFRECLKNKITPFIIDERHKQFYYRGLKEFTSTPGYLTDTCLSAQDTYTEWVKYFYPDGGFSFPAGLDV

📊 Sample Types

Isolate 2.5%
Metagenome 97.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.2%
Kalotermitidae 31.1%
Unclassified 8.9%
Rhinotermitidae 6.7%
Termopsidae 6.7%
Hodotermitidae 2.2%
Blattidae 2.2%

🌳 Taxonomy

Archaea 2
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 2820183396 Unclassified Planctomycetes Lab288P3bin214 Isolate Unclassified
23 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
24 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
32 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
33 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
34 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
35 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
38 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_376438 3300042656 Bacteria 2266
2 Ga0466733_099819 3300042659 Bacteria 6681
3 Ga0123357_10120272 3300009784 Bacteria 3311
4 Ga0123353_10874181 3300010167 Bacteria 1228
5 Ga0466719_196645 3300042606 Bacteria 7221
6 Ga0466698_475545 3300042610 Bacteria 54574
7 Ga0466735_013875 3300042624 Bacteria 1702
8 Ga0466735_067196 3300042624 Bacteria 3418
9 Ga0466709_408417 3300042648 Bacteria 5430
10 Ga0466708_001153 3300042652 Bacteria 2306
11 Ga0466708_005296 3300042652 Bacteria 1183
12 Ga0466727_078029 3300042655 Bacteria 6360
13 JGI24702J35022_10046459 3300002462 Bacteria 2312
14 JGI24702J35022_10109245 3300002462 Bacteria 1520
15 Ga0466657_284474 3300042582 Bacteria 6443
16 Ga0466692_013681 3300042591 Unclassified 8060
17 Ga0466692_202406 3300042591 Bacteria 19489
18 Ga0466696_446150 3300042596 Bacteria 1002
19 Ga0466699_094634 3300042597 Bacteria 1416
20 Ga0466729_035209 3300042621 Bacteria 2027
21 Ga0123353_10449104 3300010167 Bacteria 1899
22 Ga0466713_021884 3300042602 Bacteria 11018
23 Ga0466719_205335 3300042606 Bacteria 2719
24 Ga0466698_412756 3300042610 Bacteria 1074
25 Ga0466697_023555 3300042611 Bacteria 1265
26 Ga0466709_255588 3300042648 Bacteria 10384
27 JGI24702J35022_10002921 3300002462 Bacteria 10342
28 Ga0466696_300940 3300042596 Unclassified 1419
29 Ga0466715_217007 3300042616 Bacteria 1057
30 Ga0466728_088969 3300042620 Bacteria 52083
31 Ga0123357_10147633 3300009784 Bacteria 2866
32 Ga0123357_10160306 3300009784 Bacteria 2699
33 Ga0123353_10000200 3300010167 Bacteria 76300
34 Ga0466700_390171 3300042600 Bacteria 1759
35 Ga0466707_176408 3300042601 Archaea 3860
36 Ga0466714_155015 3300042603 Bacteria 1480
37 Ga0466716_061875 3300042605 Bacteria 1630
38 Ga0466719_152236 3300042606 Bacteria 1228
39 Ga0466721_111723 3300042608 Bacteria 1924
40 Ga0466735_139486 3300042624 Bacteria 1695
41 Ga0466704_554226 3300042643 Bacteria 7356
42 Ga0466715_324813 3300042616 Bacteria 11058
43 Ga0466715_531736 3300042616 Bacteria 5390
44 Ga0466728_118045 3300042620 Unclassified 1781
45 Ga0466705_047775 3300042612 Bacteria 1842
46 Ga0466732_277433 3300042656 Bacteria 43245
47 Ga0123353_10331481 3300010167 Bacteria 2303
48 Ga0466701_072680 3300042598 Bacteria 34156
49 Ga0466706_028370 3300042599 Bacteria 1047
50 Ga0466713_013709 3300042602 Bacteria 106354
51 Ga0466713_017574 3300042602 Bacteria 2163
52 Ga0466714_107077 3300042603 Bacteria 8551
53 Ga0466716_074570 3300042605 Bacteria 6393
54 Ga0466716_158607 3300042605 Bacteria 5334
55 Ga0466719_034555 3300042606 Bacteria 1298
56 Ga0466719_115133 3300042606 Bacteria 1871
57 Ga0466722_117769 3300042609 Bacteria 11848
58 JGI24702J35022_10140332 3300002462 Bacteria 1348
59 Ga0466695_030943 3300042595 Bacteria 1536
60 Ga0466696_381991 3300042596 Bacteria 7309
61 Ga0466711_130125 3300042615 Bacteria 2230
62 Ga0466726_063621 3300042619 Bacteria 1248
63 Ga0466726_201800 3300042619 Bacteria 2122
64 Ga0466733_138040 3300042659 Bacteria 15781
65 Ga0123356_11351585 3300010049 Bacteria 874
66 Ga0466716_159078 3300042605 Bacteria 7030
67 Ga0466722_000297 3300042609 Bacteria 3021
68 Ga0466735_000748 3300042624 Bacteria 1222
69 Ga0466709_186396 3300042648 Bacteria 7764
70 Ga0466708_013810 3300042652 Bacteria 5511
71 Ga0466725_412714 3300042654 Bacteria 41724
72 Ga0466710_082737 3300042613 Bacteria 18936
73 Ga0466726_220389 3300042619 Bacteria 4047
74 Ga0466726_444287 3300042619 Bacteria 7986
75 Ga0466728_159880 3300042620 Bacteria 2565
76 Ga0466728_282109 3300042620 Bacteria 52946
77 Ga0466733_058205 3300042659 Bacteria 1542
78 Ga0466701_049550 3300042598 Bacteria 1018
79 Ga0466707_238448 3300042601 Bacteria 5338
80 Ga0466713_017488 3300042602 Bacteria 3387
81 Ga0466703_018834 3300042636 Bacteria 1193
82 Ga0466703_190608 3300042636 Bacteria 3722
83 Ga0466704_335625 3300042643 Bacteria 6370
84 Ga0466704_387591 3300042643 Bacteria 11446
85 Ga0466704_436438 3300042643 Bacteria 4772
86 Ga0466708_038412 3300042652 Bacteria 20757
87 Ga0466708_044239 3300042652 Bacteria 19177
88 Ga0466708_454693 3300042652 Bacteria 5429
89 Ga0466691_102398 3300042593 Bacteria 3118
90 Ga0466711_088695 3300042615 Bacteria 1794
91 Ga0466711_135908 3300042615 Bacteria 1974
92 Ga0466711_145170 3300042615 Bacteria 12977
93 Ga0466726_271585 3300042619 Bacteria 1526
94 Ga0466705_221322 3300042612 Unclassified 6855
95 Ga0123356_10041612 3300010049 Archaea 4281
96 Ga0123356_10539595 3300010049 Bacteria 1326
97 Ga0123353_10060365 3300010167 Bacteria 6081
98 Ga0466714_138242 3300042603 Bacteria 2104
99 Ga0466719_336419 3300042606 Bacteria 2999
100 Ga0466727_201586 3300042655 Bacteria 8243
101 JGI24698J34947_10006200 3300002449 Bacteria 6570
102 Ga0466657_120220 3300042582 Bacteria 3602
103 Ga0466690_109982 3300042590 Bacteria 42880
104 Ga0466690_120538 3300042590 Bacteria 7496
105 Ga0466723_014070 3300042618 Bacteria 20985
106 Ga0466729_103814 3300042621 Bacteria 4388
107 Ga0466700_067216 3300042600 Bacteria 2006
108 Ga0466713_154923 3300042602 Bacteria 2310
109 Ga0466719_022368 3300042606 Bacteria 2800
110 Ga0466719_243168 3300042606 Bacteria 9742
111 Ga0466719_533995 3300042606 Bacteria 5911
112 JGI24698J34947_10046349 3300002449 Bacteria 2212
113 Ga0466656_050653 3300042550 Bacteria 1035
114 Ga0466690_192749 3300042590 Bacteria 2301
115 Ga0466690_239292 3300042590 Bacteria 1561
116 Ga0466705_476239 3300042612 Bacteria 4123
117 Ga0466723_348224 3300042618 Bacteria 7767
118 Ga0466728_275390 3300042620 Bacteria 1827

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002449 JGI24698J34947_10006200 JGI24698J34947_100062006 231
2 3300042593 Ga0466691_102398 Ga0466691_102398_1995_2702 235
3 3300042659 Ga0466733_099819 Ga0466733_099819_4962_5669 235
4 3300042615 Ga0466711_088695 Ga0466711_088695_783_1496 237
5 3300042643 Ga0466704_387591 Ga0466704_387591_7365_8078 237
6 3300042590 Ga0466690_109982 Ga0466690_109982_28876_29592 238
7 3300042599 Ga0466706_028370 Ga0466706_028370_47_763 238
8 3300009784 Ga0123357_10160306 Ga0123357_101603062 239
9 3300010049 Ga0123356_10041612 Ga0123356_100416121 239
10 3300010167 Ga0123353_10874181 Ga0123353_108741811 239
11 3300042602 Ga0466713_017574 Ga0466713_017574_267_986 239
12 3300042602 Ga0466713_154923 Ga0466713_154923_246_965 239
13 3300042659 Ga0466733_138040 Ga0466733_138040_11011_11730 239
14 3300042603 Ga0466714_155015 Ga0466714_155015_720_1442 240
15 3300042605 Ga0466716_061875 Ga0466716_061875_828_1550 240
16 3300042605 Ga0466716_074570 Ga0466716_074570_5054_5776 240
17 3300042605 Ga0466716_158607 Ga0466716_158607_4532_5254 240
18 3300042605 Ga0466716_159078 Ga0466716_159078_1578_2300 240
19 3300042606 Ga0466719_115133 Ga0466719_115133_800_1522 240
20 3300042606 Ga0466719_243168 Ga0466719_243168_4736_5458 240
21 3300042616 Ga0466715_217007 Ga0466715_217007_275_997 240
22 3300042619 Ga0466726_063621 Ga0466726_063621_273_995 240
23 3300042620 Ga0466728_118045 Ga0466728_118045_896_1618 240
24 3300042620 Ga0466728_159880 Ga0466728_159880_1212_1934 240
25 3300042648 Ga0466709_408417 Ga0466709_408417_4418_5140 240
26 3300042652 Ga0466708_038412 Ga0466708_038412_16819_17541 240
27 3300042652 Ga0466708_454693 Ga0466708_454693_4615_5337 240
28 3300042656 Ga0466732_376438 Ga0466732_376438_942_1664 240
29 3300042659 Ga0466733_058205 Ga0466733_058205_204_926 240
30 iso_pr_bacteria 2820183396 2820184172 240
31 3300002449 JGI24698J34947_10046349 JGI24698J34947_100463492 241
32 3300010167 Ga0123353_10000200 Ga0123353_1000020026 241
33 3300042590 Ga0466690_120538 Ga0466690_120538_2943_3668 241
34 3300042591 Ga0466692_013681 Ga0466692_013681_2104_2829 241
35 3300042598 Ga0466701_049550 Ga0466701_049550_80_805 241
36 3300042600 Ga0466700_390171 Ga0466700_390171_935_1660 241
37 3300042615 Ga0466711_130125 Ga0466711_130125_13_738 241
38 3300042615 Ga0466711_135908 Ga0466711_135908_13_738 241
39 3300042619 Ga0466726_444287 Ga0466726_444287_6868_7593 241
40 3300042620 Ga0466728_088969 Ga0466728_088969_47242_47967 241
41 3300042620 Ga0466728_275390 Ga0466728_275390_980_1705 241
42 iso_pr_bacteria 2778260940 2778357472 241
43 iso_pr_bacteria 2940195863 2940196752 241
44 3300042590 Ga0466690_192749 Ga0466690_192749_921_1649 242
45 3300042596 Ga0466696_300940 Ga0466696_300940_587_1315 242
46 3300042597 Ga0466699_094634 Ga0466699_094634_512_1240 242
47 3300042601 Ga0466707_238448 Ga0466707_238448_3562_4290 242
48 3300042603 Ga0466714_107077 Ga0466714_107077_2523_3251 242
49 3300042606 Ga0466719_196645 Ga0466719_196645_5105_5833 242
50 3300042610 Ga0466698_412756 Ga0466698_412756_224_952 242
51 3300042612 Ga0466705_221322 Ga0466705_221322_917_1645 242
52 3300042615 Ga0466711_145170 Ga0466711_145170_3509_4237 242
53 3300042616 Ga0466715_531736 Ga0466715_531736_1658_2386 242
54 3300042619 Ga0466726_220389 Ga0466726_220389_2235_2963 242
55 3300042621 Ga0466729_035209 Ga0466729_035209_771_1499 242
56 3300042624 Ga0466735_067196 Ga0466735_067196_449_1177 242
57 3300042636 Ga0466703_190608 Ga0466703_190608_1495_2223 242
58 3300042643 Ga0466704_436438 Ga0466704_436438_929_1657 242
59 3300042655 Ga0466727_078029 Ga0466727_078029_760_1488 242
60 3300002462 JGI24702J35022_10002921 JGI24702J35022_1000292112 243
61 3300002462 JGI24702J35022_10046459 JGI24702J35022_100464592 243
62 3300010167 Ga0123353_10060365 Ga0123353_100603654 243
63 3300042591 Ga0466692_202406 Ga0466692_202406_12182_12913 243
64 3300042595 Ga0466695_030943 Ga0466695_030943_233_964 243
65 3300042596 Ga0466696_381991 Ga0466696_381991_195_926 243
66 3300042602 Ga0466713_013709 Ga0466713_013709_11692_12423 243
67 3300042602 Ga0466713_017488 Ga0466713_017488_1178_1909 243
68 3300042610 Ga0466698_475545 Ga0466698_475545_8542_9273 243
69 3300042648 Ga0466709_255588 Ga0466709_255588_5111_5842 243
70 3300042652 Ga0466708_001153 Ga0466708_001153_556_1287 243
71 3300002462 JGI24702J35022_10140332 JGI24702J35022_101403322 244
72 3300009784 Ga0123357_10120272 Ga0123357_101202722 244
73 3300042596 Ga0466696_446150 Ga0466696_446150_63_797 244
74 3300042608 Ga0466721_111723 Ga0466721_111723_435_1169 244
75 3300042612 Ga0466705_047775 Ga0466705_047775_328_1062 244
76 3300042612 Ga0466705_476239 Ga0466705_476239_367_1101 244
77 3300042613 Ga0466710_082737 Ga0466710_082737_2464_3198 244
78 3300042618 Ga0466723_014070 Ga0466723_014070_359_1093 244
79 3300042620 Ga0466728_282109 Ga0466728_282109_47939_48673 244
80 3300042624 Ga0466735_000748 Ga0466735_000748_206_940 244
81 3300042643 Ga0466704_335625 Ga0466704_335625_628_1362 244
82 3300042655 Ga0466727_201586 Ga0466727_201586_191_925 244
83 3300010049 Ga0123356_10539595 Ga0123356_105395952 245
84 3300010167 Ga0123353_10331481 Ga0123353_103314812 245
85 3300042598 Ga0466701_072680 Ga0466701_072680_21537_22274 245
86 3300042602 Ga0466713_021884 Ga0466713_021884_2586_3323 245
87 3300010049 Ga0123356_11351585 Ga0123356_113515851 246
88 3300042600 Ga0466700_067216 Ga0466700_067216_304_1044 246
89 3300042606 Ga0466719_034555 Ga0466719_034555_135_875 246
90 3300042609 Ga0466722_117769 Ga0466722_117769_3318_4058 246
91 3300042618 Ga0466723_348224 Ga0466723_348224_4703_5443 246
92 3300042619 Ga0466726_201800 Ga0466726_201800_629_1369 246
93 3300042636 Ga0466703_018834 Ga0466703_018834_248_988 246
94 3300042652 Ga0466708_013810 Ga0466708_013810_2730_3470 246
95 3300042582 Ga0466657_284474 Ga0466657_284474_3113_3856 247
96 3300042609 Ga0466722_000297 Ga0466722_000297_806_1576 247
97 3300042652 Ga0466708_005296 Ga0466708_005296_318_1061 247
98 3300042611 Ga0466697_023555 Ga0466697_023555_118_864 248
99 3300042624 Ga0466735_013875 Ga0466735_013875_632_1378 248
100 3300042624 Ga0466735_139486 Ga0466735_139486_103_849 248
101 3300042606 Ga0466719_533995 Ga0466719_533995_89_838 249
102 3300009784 Ga0123357_10147633 Ga0123357_101476332 250
103 3300010167 Ga0123353_10449104 Ga0123353_104491042 250
104 3300042621 Ga0466729_103814 Ga0466729_103814_3264_4052 250
105 3300042550 Ga0466656_050653 Ga0466656_050653_47_802 251
106 3300042582 Ga0466657_120220 Ga0466657_120220_491_1249 252
107 3300042601 Ga0466707_176408 Ga0466707_176408_2845_3603 252
108 3300042656 Ga0466732_277433 Ga0466732_277433_35596_36354 252
109 3300042603 Ga0466714_138242 Ga0466714_138242_841_1602 253
110 3300042606 Ga0466719_152236 Ga0466719_152236_454_1215 253
111 3300042616 Ga0466715_324813 Ga0466715_324813_5101_5862 253
112 3300002462 JGI24702J35022_10109245 JGI24702J35022_101092453 255
113 3300042590 Ga0466690_239292 Ga0466690_239292_44_811 255
114 3300042619 Ga0466726_271585 Ga0466726_271585_661_1428 255
115 3300042648 Ga0466709_186396 Ga0466709_186396_4341_5111 256
116 3300042606 Ga0466719_022368 Ga0466719_022368_1330_2103 257
117 3300042643 Ga0466704_554226 Ga0466704_554226_1567_2346 259
118 3300042606 Ga0466719_336419 Ga0466719_336419_294_1079 261
119 3300042654 Ga0466725_412714 Ga0466725_412714_22465_23253 262
120 3300042652 Ga0466708_044239 Ga0466708_044239_2030_2896 264
121 3300042606 Ga0466719_205335 Ga0466719_205335_488_1345 285

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02661 Fic Fic/DOC family 122 218 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.