Protein Family IF06514

Metagenome Isolate
126 Members
33 Samples
116 Scaffolds
249.75 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_197898|Ga0466719_197898_427_1371
Length
295 aa
Sequence
LTEAPQGQAWALSDVLPRLFFHSNLELPGESLFSFLPEAMIQFMRWFSGLNGTLQALLACLFTYGVTALGSAMVFFFKSINRKVLDGMLGFAGGVMIAASFFSLLAPAITMAEVVHESGRGLPAWAAAVIGFILGGAFLRLADTLLPHLHVGMKSAEGIKTNWGRSALLVLAITLHNIPEGLAVGVGFGAASTIPGASLAGALPLRREGMSRLRSFWIGQASGIVEPIAGVLGAALVMSMQAVLPYALSFAAGAMIFVVAEELIPEAYAEGNDHIATSGIVLGFALMMALDVGLG

📊 Sample Types

Isolate 7.9%
Metagenome 92.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 42.4%
Culicidae 24.2%
Unclassified 12.1%
Termopsidae 9.1%
Rhinotermitidae 6.1%
Hodotermitidae 3.0%
Termitidae 3.0%

🌳 Taxonomy

Archaea 0
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2964145936 Entomospira culicis BR149 Isolate Culicidae
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 8063587521 Entomospira entomophilus BR193 Isolate Culicidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 2964266314 Entomospira nematocera BR208 Isolate Culicidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 8063595521 Entomospira culicis BR149 Isolate Culicidae
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 2964144231 Entomospira culicis BR151 Isolate Culicidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2964130733 Entomospira entomophilus BR193 Isolate Culicidae
22 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
23 650716102 Treponema primitia ZAS-2 Isolate Unclassified
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 8063589291 Entomospira nematocera BR208 Isolate Culicidae
26 8063597228 Entomospira culicis BR151 Isolate Culicidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_083070 3300042612 Bacteria 39024
2 Ga0466705_142428 3300042612 Unclassified 6397
3 Ga0466705_199747 3300042612 Bacteria 2879
4 Ga0466705_412095 3300042612 Bacteria 7608
5 Ga0466711_085756 3300042615 Bacteria 33515
6 Ga0466711_226810 3300042615 Bacteria 3037
7 Ga0466715_004485 3300042616 Bacteria 24028
8 Ga0466715_064769 3300042616 Bacteria 19592
9 Ga0466715_439070 3300042616 Bacteria 5379
10 Ga0466723_044402 3300042618 Bacteria 11711
11 Ga0466728_168063 3300042620 Bacteria 2634
12 Ga0466691_080851 3300042593 Bacteria 5272
13 Ga0466691_179701 3300042593 Bacteria 6417
14 Ga0466706_211051 3300042599 Bacteria 2510
15 Ga0466713_070599 3300042602 Bacteria 4419
16 Ga0466719_030407 3300042606 Bacteria 6575
17 Ga0466719_091732 3300042606 Bacteria 18239
18 Ga0466735_095327 3300042624 Bacteria 3550
19 Ga0466703_212383 3300042636 Bacteria 15812
20 Ga0466703_331607 3300042636 Bacteria 15314
21 Ga0466704_146920 3300042643 Bacteria 28455
22 Ga0466709_197497 3300042648 Bacteria 5303
23 Ga0466708_047304 3300042652 Bacteria 2703
24 Ga0466727_211195 3300042655 Bacteria 1934
25 Ga0466705_313708 3300042612 Bacteria 7883
26 Ga0466705_404810 3300042612 Bacteria 1652
27 Ga0466711_165478 3300042615 Bacteria 2161
28 Ga0466715_646411 3300042616 Bacteria 11155
29 Ga0466726_460980 3300042619 Unclassified 1162
30 Ga0466728_076390 3300042620 Bacteria 3412
31 Ga0466696_333914 3300042596 Bacteria 5694
32 Ga0466735_033595 3300042624 Unclassified 1605
33 Ga0466703_007150 3300042636 Bacteria 7926
34 Ga0466704_170173 3300042643 Bacteria 13167
35 Ga0466704_441677 3300042643 Unclassified 6648
36 Ga0466709_107674 3300042648 Bacteria 3387
37 Ga0466727_108477 3300042655 Unclassified 2906
38 Ga0466705_204513 3300042612 Bacteria 8817
39 Ga0466733_205711 3300042659 Bacteria 1234
40 Ga0466711_014343 3300042615 Bacteria 4453
41 Ga0466715_476209 3300042616 Bacteria 12373
42 Ga0466723_088841 3300042618 Bacteria 2752
43 Ga0466726_369754 3300042619 Bacteria 2216
44 Ga0466692_149528 3300042591 Bacteria 25005
45 Ga0466696_165650 3300042596 Bacteria 8560
46 Ga0466713_123048 3300042602 Bacteria 1388
47 Ga0466719_445654 3300042606 Unclassified 1840
48 Ga0466704_288260 3300042643 Bacteria 16251
49 Ga0466709_035229 3300042648 Bacteria 2099
50 Ga0466727_187717 3300042655 Bacteria 2386
51 Ga0466727_266391 3300042655 Bacteria 17904
52 Ga0466705_318531 3300042612 Bacteria 1692
53 Ga0466733_012376 3300042659 Bacteria 51013
54 Ga0466711_086068 3300042615 Bacteria 9631
55 Ga0466715_246166 3300042616 Unclassified 5304
56 Ga0466715_353120 3300042616 Bacteria 2910
57 Ga0466715_427158 3300042616 Bacteria 13811
58 Ga0466723_042467 3300042618 Bacteria 7608
59 Ga0466726_164196 3300042619 Bacteria 13549
60 Ga0466726_261034 3300042619 Bacteria 2700
61 Ga0466690_236173 3300042590 Bacteria 2651
62 Ga0466692_116451 3300042591 Bacteria 68874
63 Ga0466704_068054 3300042643 Bacteria 10568
64 Ga0466704_368337 3300042643 Bacteria 25914
65 Ga0466704_421051 3300042643 Bacteria 2554
66 Ga0466705_008883 3300042612 Bacteria 10527
67 Ga0466705_026607 3300042612 Bacteria 47022
68 Ga0466733_040471 3300042659 Bacteria 4916
69 Ga0466711_169796 3300042615 Bacteria 7812
70 Ga0466723_340850 3300042618 Bacteria 7615
71 Ga0466728_139263 3300042620 Bacteria 1881
72 Ga0466691_013075 3300042593 Bacteria 2924
73 Ga0466719_171428 3300042606 Bacteria 2383
74 Ga0466719_197898 3300042606 Bacteria 1995
75 Ga0466719_277720 3300042606 Unclassified 1445
76 Ga0466703_091206 3300042636 Bacteria 37744
77 Ga0466709_221410 3300042648 Unclassified 1119
78 Ga0466727_298750 3300042655 Bacteria 1239
79 Ga0466726_070152 3300042619 Bacteria 1786
80 Ga0466690_375064 3300042590 Bacteria 3250
81 Ga0466692_029373 3300042591 Bacteria 8369
82 Ga0466691_055340 3300042593 Bacteria 2160
83 Ga0466716_015282 3300042605 Bacteria 25597
84 Ga0466719_004965 3300042606 Bacteria 1667
85 Ga0466722_021724 3300042609 Bacteria 2511
86 Ga0466704_202786 3300042643 Bacteria 17396
87 Ga0466705_244568 3300042612 Bacteria 5562
88 Ga0466705_352334 3300042612 Bacteria 6614
89 Ga0466733_188288 3300042659 Bacteria 1396
90 Ga0466733_189248 3300042659 Bacteria 27547
91 Ga0466723_094839 3300042618 Bacteria 11689
92 Ga0466726_015009 3300042619 Bacteria 1851
93 Ga0466696_059871 3300042596 Bacteria 12619
94 Ga0466704_005795 3300042643 Unclassified 5457
95 Ga0466704_198458 3300042643 Bacteria 5129
96 Ga0466709_320867 3300042648 Bacteria 6336
97 Ga0466727_095687 3300042655 Bacteria 8107
98 Ga0466705_151298 3300042612 Bacteria 3407
99 Ga0466705_312245 3300042612 Bacteria 4771
100 Ga0466705_409646 3300042612 Bacteria 11567
101 Ga0466711_047179 3300042615 Bacteria 21134
102 Ga0466715_024137 3300042616 Unclassified 3120
103 Ga0466715_306652 3300042616 Bacteria 11984
104 Ga0466726_048963 3300042619 Bacteria 2961
105 Ga0466726_284016 3300042619 Bacteria 1595
106 Ga0466728_292926 3300042620 Bacteria 3497
107 Ga0466728_434424 3300042620 Bacteria 2584
108 Ga0466692_028408 3300042591 Bacteria 1997
109 Ga0466692_167727 3300042591 Bacteria 5007
110 Ga0466696_114477 3300042596 Bacteria 20348
111 Ga0466707_073489 3300042601 Bacteria 1390
112 Ga0466713_076140 3300042602 Bacteria 1614
113 Ga0466719_282182 3300042606 Bacteria 5143
114 Ga0466703_105104 3300042636 Bacteria 5995
115 Ga0466704_173997 3300042643 Bacteria 7270
116 Ga0466708_104645 3300042652 Bacteria 9725

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_094839 Ga0466723_094839_4313_5122 233
2 3300042655 Ga0466727_298750 Ga0466727_298750_125_934 233
3 3300042615 Ga0466711_086068 Ga0466711_086068_420_1229 237
4 3300042596 Ga0466696_114477 Ga0466696_114477_15154_15945 238
5 3300042643 Ga0466704_288260 Ga0466704_288260_12745_13575 239
6 3300042601 Ga0466707_073489 Ga0466707_073489_104_913 241
7 3300042616 Ga0466715_246166 Ga0466715_246166_3471_4292 241
8 3300042619 Ga0466726_048963 Ga0466726_048963_989_1798 241
9 3300042624 Ga0466735_033595 Ga0466735_033595_77_886 241
10 3300042624 Ga0466735_095327 Ga0466735_095327_2550_3359 241
11 3300042643 Ga0466704_198458 Ga0466704_198458_2372_3187 241
12 3300042652 Ga0466708_104645 Ga0466708_104645_3997_4806 241
13 3300042655 Ga0466727_187717 Ga0466727_187717_803_1624 241
14 3300042606 Ga0466719_445654 Ga0466719_445654_479_1294 242
15 3300042615 Ga0466711_047179 Ga0466711_047179_6617_7420 242
16 3300042619 Ga0466726_015009 Ga0466726_015009_611_1420 242
17 3300042619 Ga0466726_164196 Ga0466726_164196_10865_11674 242
18 3300042643 Ga0466704_005795 Ga0466704_005795_666_1472 242
19 3300042612 Ga0466705_026607 Ga0466705_026607_28016_28831 243
20 3300042612 Ga0466705_142428 Ga0466705_142428_1595_2422 243
21 3300042615 Ga0466711_014343 Ga0466711_014343_253_1068 243
22 3300042615 Ga0466711_226810 Ga0466711_226810_1813_2628 243
23 3300042619 Ga0466726_369754 Ga0466726_369754_1018_1827 243
24 3300042636 Ga0466703_091206 Ga0466703_091206_26315_27124 243
25 3300042659 Ga0466733_040471 Ga0466733_040471_2686_3495 243
26 3300042612 Ga0466705_244568 Ga0466705_244568_1296_2099 244
27 3300042612 Ga0466705_352334 Ga0466705_352334_62_871 244
28 3300042615 Ga0466711_085756 Ga0466711_085756_16604_17416 244
29 3300042618 Ga0466723_044402 Ga0466723_044402_6420_7229 244
30 3300042636 Ga0466703_105104 Ga0466703_105104_4968_5774 244
31 3300042596 Ga0466696_059871 Ga0466696_059871_6500_7309 245
32 3300042652 Ga0466708_047304 Ga0466708_047304_156_965 245
33 3300042655 Ga0466727_095687 Ga0466727_095687_6367_7182 245
34 3300042655 Ga0466727_266391 Ga0466727_266391_12188_13003 245
35 3300042659 Ga0466733_189248 Ga0466733_189248_7413_8222 245
36 3300042596 Ga0466696_165650 Ga0466696_165650_871_1680 246
37 3300042606 Ga0466719_004965 Ga0466719_004965_495_1319 246
38 3300042612 Ga0466705_151298 Ga0466705_151298_510_1328 246
39 3300042615 Ga0466711_165478 Ga0466711_165478_277_1086 246
40 3300042616 Ga0466715_024137 Ga0466715_024137_1685_2491 246
41 3300042616 Ga0466715_306652 Ga0466715_306652_4665_5480 246
42 3300042620 Ga0466728_168063 Ga0466728_168063_980_1789 246
43 3300042636 Ga0466703_212383 Ga0466703_212383_14956_15759 246
44 3300042643 Ga0466704_170173 Ga0466704_170173_2986_3795 246
45 3300042648 Ga0466709_107674 Ga0466709_107674_940_1764 246
46 3300042659 Ga0466733_012376 Ga0466733_012376_23636_24445 246
47 3300042590 Ga0466690_236173 Ga0466690_236173_1296_2105 247
48 3300042591 Ga0466692_028408 Ga0466692_028408_1054_1869 247
49 3300042606 Ga0466719_277720 Ga0466719_277720_148_960 247
50 3300042612 Ga0466705_199747 Ga0466705_199747_1791_2606 247
51 3300042612 Ga0466705_404810 Ga0466705_404810_507_1316 247
52 3300042618 Ga0466723_042467 Ga0466723_042467_1101_1910 247
53 3300042620 Ga0466728_434424 Ga0466728_434424_1160_1975 247
54 3300042636 Ga0466703_007150 Ga0466703_007150_6047_6862 247
55 3300042643 Ga0466704_146920 Ga0466704_146920_23517_24338 247
56 3300042659 Ga0466733_188288 Ga0466733_188288_56_865 247
57 3300042659 Ga0466733_205711 Ga0466733_205711_57_866 247
58 3300042602 Ga0466713_076140 Ga0466713_076140_745_1548 248
59 3300042612 Ga0466705_312245 Ga0466705_312245_3546_4358 248
60 3300042612 Ga0466705_313708 Ga0466705_313708_428_1243 248
61 3300042612 Ga0466705_409646 Ga0466705_409646_6498_7307 248
62 3300042616 Ga0466715_353120 Ga0466715_353120_565_1398 248
63 3300042616 Ga0466715_427158 Ga0466715_427158_6613_7425 248
64 3300042616 Ga0466715_646411 Ga0466715_646411_2238_3050 248
65 3300042618 Ga0466723_340850 Ga0466723_340850_2533_3342 248
66 3300042620 Ga0466728_076390 Ga0466728_076390_369_1178 248
67 3300042643 Ga0466704_173997 Ga0466704_173997_4749_5561 248
68 3300042643 Ga0466704_421051 Ga0466704_421051_1040_1849 248
69 3300042648 Ga0466709_197497 Ga0466709_197497_971_1783 248
70 3300042590 Ga0466690_375064 Ga0466690_375064_430_1245 249
71 3300042591 Ga0466692_029373 Ga0466692_029373_4836_5657 249
72 3300042591 Ga0466692_149528 Ga0466692_149528_21556_22377 249
73 3300042591 Ga0466692_167727 Ga0466692_167727_2438_3259 249
74 3300042602 Ga0466713_123048 Ga0466713_123048_156_971 249
75 3300042605 Ga0466716_015282 Ga0466716_015282_17366_18181 249
76 3300042606 Ga0466719_091732 Ga0466719_091732_9837_10652 249
77 3300042618 Ga0466723_088841 Ga0466723_088841_1403_2218 249
78 3300042619 Ga0466726_261034 Ga0466726_261034_997_1812 249
79 3300042620 Ga0466728_139263 Ga0466728_139263_666_1481 249
80 3300042636 Ga0466703_331607 Ga0466703_331607_67_882 249
81 3300042643 Ga0466704_202786 Ga0466704_202786_8116_8931 249
82 3300042655 Ga0466727_108477 Ga0466727_108477_1504_2319 249
83 3300042655 Ga0466727_211195 Ga0466727_211195_871_1686 249
84 3300042591 Ga0466692_116451 Ga0466692_116451_51462_52277 250
85 3300042593 Ga0466691_013075 Ga0466691_013075_1393_2208 250
86 3300042593 Ga0466691_055340 Ga0466691_055340_283_1092 250
87 3300042596 Ga0466696_333914 Ga0466696_333914_3735_4562 250
88 3300042599 Ga0466706_211051 Ga0466706_211051_1146_1961 250
89 3300042602 Ga0466713_070599 Ga0466713_070599_2670_3488 250
90 3300042606 Ga0466719_282182 Ga0466719_282182_2658_3473 250
91 3300042612 Ga0466705_008883 Ga0466705_008883_2821_3636 250
92 3300042612 Ga0466705_204513 Ga0466705_204513_3104_3913 250
93 3300042616 Ga0466715_064769 Ga0466715_064769_9651_10466 250
94 3300042619 Ga0466726_070152 Ga0466726_070152_402_1217 250
95 3300042620 Ga0466728_292926 Ga0466728_292926_1382_2197 250
96 3300042643 Ga0466704_441677 Ga0466704_441677_2718_3533 250
97 3300042648 Ga0466709_320867 Ga0466709_320867_3955_4770 250
98 3300042615 Ga0466711_169796 Ga0466711_169796_326_1141 251
99 3300042648 Ga0466709_221410 Ga0466709_221410_212_1027 251
100 3300042593 Ga0466691_179701 Ga0466691_179701_772_1587 252
101 3300042606 Ga0466719_030407 Ga0466719_030407_5307_6122 252
102 3300042606 Ga0466719_171428 Ga0466719_171428_451_1266 252
103 3300042612 Ga0466705_083070 Ga0466705_083070_4836_5657 252
104 3300042612 Ga0466705_318531 Ga0466705_318531_390_1205 252
105 3300042612 Ga0466705_412095 Ga0466705_412095_5375_6190 252
106 3300042616 Ga0466715_004485 Ga0466715_004485_2829_3644 252
107 3300042616 Ga0466715_476209 Ga0466715_476209_1002_1817 252
108 3300042619 Ga0466726_284016 Ga0466726_284016_439_1254 252
109 3300042619 Ga0466726_460980 Ga0466726_460980_148_963 252
110 3300042643 Ga0466704_068054 Ga0466704_068054_6265_7080 252
111 3300042643 Ga0466704_368337 Ga0466704_368337_1959_2780 252
112 3300042593 Ga0466691_080851 Ga0466691_080851_1112_1960 260
113 3300042648 Ga0466709_035229 Ga0466709_035229_776_1657 261
114 3300042616 Ga0466715_439070 Ga0466715_439070_2161_3045 265
115 iso_pr_bacteria 650716102 650883791 269
116 iso_pr_bacteria 2964144231 2964144498 270
117 iso_pr_bacteria 2964145936 2964146386 270
118 iso_pr_bacteria 2964266314 2964266745 270
119 iso_pr_bacteria 8063589291 8063590196 270
120 iso_pr_bacteria 8063595521 8063595974 270
121 iso_pr_bacteria 8063597228 8063597677 270
122 iso_pr_bacteria 650716099 650878155 271
123 iso_pr_bacteria 2964130733 2964131684 272
124 iso_pr_bacteria 8063587521 8063588471 272
125 3300042606 Ga0466719_197898 Ga0466719_197898_427_1371 295
126 3300042609 Ga0466722_021724 Ga0466722_021724_1506_2501 309

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02535 Zip ZIP Zinc transporter 165 290 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.66 0.73 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.