Protein Family IF06488

Metagenome Isolate
124 Members
40 Samples
120 Scaffolds
477.79 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_130425|Ga0466719_130425_455_1963
Length
502 aa
Sequence
MREAQQTADNAEWRPNTSALFTDFYSLTMAHGYWKKNINHRAVFEMFFRRQPFGGGFTVFAGLTDFLEKLKNFHYSPEDIAYLRGLKVFDQGFLDYLSHFRFTGSILALDEGSVVFPQEPLIRVDSSLIECQIIEGMLLNIINFQSLIATKTARVWLASGKGSVLEFGLRRAQGPDGAMSATRAAYIGGAMGTSNTLGGKVYGIPVIGTMAHAWIMAFPSEEEAFQAYADIYPGRTVFLIDTYDTLKSGVPNAIKVGRKLVEQGKNFGVRLDSGDIHYLSVEVRKLLDEAGFPQATITVSNDLDETIIHTLKEAGAPINSWGVGTQMVTGGTEAAFTGVYKLAAKGDGSGRLIPAMKFSDNLEKTTTPGVKQVWRIKDPAGMAVADVLTLEEDPEGPDTLEKGKRYSFWHPAADYRHFYHEISGSVEQGLKPRMEKGELFPGPGLGEIRARVEADLDSFDASYKRLLNPHVYKVSFTDRLRKLKLELINNYLGDLDPQGPVT

📊 Sample Types

Isolate 3.2%
Metagenome 96.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.9%
Kalotermitidae 35.9%
Unclassified 12.8%
Termopsidae 7.7%
Rhinotermitidae 7.7%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
2 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
5 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
6 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
9 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
10 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
13 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
38 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_064002 3300042612 Bacteria 16007
2 Ga0072940_1034580 3300005200 Bacteria 3366
3 Ga0466722_062343 3300042609 Bacteria 13257
4 Ga0264413_101090 3300024493 Bacteria 21368
5 Ga0466692_037966 3300042591 Bacteria 12197
6 Ga0466696_010999 3300042596 Bacteria 16877
7 Ga0466696_065148 3300042596 Bacteria 3376
8 Ga0466699_189430 3300042597 Bacteria 4827
9 Ga0466711_254685 3300042615 Bacteria 14104
10 Ga0466715_101121 3300042616 Bacteria 10528
11 Ga0466728_050842 3300042620 Bacteria 3113
12 Ga0466735_133724 3300042624 Bacteria 1458
13 Ga0466703_075318 3300042636 Bacteria 4524
14 Ga0466703_140559 3300042636 Bacteria 49074
15 Ga0466703_409321 3300042636 Bacteria 56299
16 Ga0466704_401846 3300042643 Bacteria 10351
17 Ga0466704_409633 3300042643 Bacteria 18291
18 Ga0466704_537964 3300042643 Bacteria 2316
19 Ga0466709_040343 3300042648 Bacteria 6770
20 Ga0466709_396745 3300042648 Bacteria 6202
21 Ga0123357_10057600 3300009784 Bacteria 5221
22 AustNasuHG_c1004979 3300000089 Bacteria 4754
23 Ga0415639_074643 3300038395 Bacteria 6059
24 Ga0466711_397261 3300042615 Bacteria 11139
25 Ga0466715_189786 3300042616 Bacteria 2591
26 Ga0466726_114674 3300042619 Bacteria 4588
27 Ga0466728_158641 3300042620 Bacteria 5806
28 Ga0466708_135822 3300042652 Bacteria 13393
29 Ga0466708_208309 3300042652 Bacteria 15912
30 AustNasuHG_c1005319 3300000089 Bacteria 4600
31 Ga0466719_130425 3300042606 Bacteria 2432
32 Ga0466719_276693 3300042606 Bacteria 2713
33 Ga0466722_075258 3300042609 Bacteria 10830
34 Ga0466722_202638 3300042609 Bacteria 35532
35 Ga0466690_029331 3300042590 Bacteria 8628
36 Ga0466690_247656 3300042590 Bacteria 6080
37 Ga0466696_012033 3300042596 Bacteria 20107
38 Ga0466696_151220 3300042596 Bacteria 13717
39 Ga0466696_231711 3300042596 Bacteria 11281
40 Ga0466715_189366 3300042616 Bacteria 18404
41 Ga0466723_198636 3300042618 Bacteria 33456
42 Ga0466726_417747 3300042619 Bacteria 2082
43 Ga0466728_125333 3300042620 Bacteria 6574
44 Ga0466728_157294 3300042620 Bacteria 9968
45 Ga0466704_567552 3300042643 Bacteria 13451
46 Ga0123355_10003855 3300009826 Bacteria 21692
47 Ga0466705_105191 3300042612 Bacteria 20972
48 Ga0466705_369622 3300042612 Bacteria 26304
49 Ga0466720_069001 3300042607 Bacteria 13682
50 Ga0466691_019176 3300042593 Bacteria 33350
51 Ga0466691_130929 3300042593 Bacteria 17359
52 Ga0466695_366562 3300042595 Bacteria 7991
53 Ga0466699_438480 3300042597 Bacteria 45456
54 Ga0466723_056839 3300042618 Bacteria 12967
55 Ga0466728_118578 3300042620 Bacteria 8729
56 Ga0466704_296077 3300042643 Unclassified 3507
57 Ga0466709_080861 3300042648 Unclassified 8919
58 Ga0466708_173976 3300042652 Bacteria 9149
59 Ga0466708_416996 3300042652 Bacteria 3693
60 JGI24695J34938_10000044 3300002450 Bacteria 93214
61 Ga0466707_161334 3300042601 Bacteria 3624
62 Ga0466716_076460 3300042605 Bacteria 6182
63 Ga0466719_362189 3300042606 Bacteria 6764
64 Ga0466722_123343 3300042609 Bacteria 31379
65 Ga0466690_248693 3300042590 Bacteria 9161
66 Ga0466692_140863 3300042591 Bacteria 8775
67 Ga0466711_202959 3300042615 Bacteria 30412
68 Ga0466718_047819 3300042617 Unclassified 1184
69 Ga0466726_030734 3300042619 Bacteria 2078
70 Ga0466726_399508 3300042619 Bacteria 2470
71 Ga0466703_097237 3300042636 Bacteria 9615
72 Ga0466703_099313 3300042636 Bacteria 6715
73 Ga0466703_135593 3300042636 Bacteria 14337
74 Ga0466704_076746 3300042643 Bacteria 10665
75 Ga0466704_099104 3300042643 Bacteria 24492
76 Ga0466704_151874 3300042643 Bacteria 14749
77 Ga0466727_154496 3300042655 Bacteria 3543
78 Ga0466727_299598 3300042655 Bacteria 13678
79 Ga0123353_10021612 3300010167 Bacteria 9662
80 Ga0466705_089647 3300042612 Bacteria 4167
81 Ga0466705_129956 3300042612 Bacteria 6102
82 JGI24695J34938_10000042 3300002450 Bacteria 95222
83 Ga0466719_199083 3300042606 Bacteria 19265
84 Ga0466722_073510 3300042609 Bacteria 10049
85 Ga0264413_103200 3300024493 Bacteria 13813
86 Ga0466694_220062 3300042594 Bacteria 3238
87 Ga0466699_132676 3300042597 Bacteria 5318
88 Ga0466705_509521 3300042612 Unclassified 4837
89 Ga0466715_177257 3300042616 Bacteria 4707
90 Ga0466735_001466 3300042624 Bacteria 5844
91 Ga0466703_313686 3300042636 Bacteria 39291
92 Ga0466709_217120 3300042648 Unclassified 13602
93 Ga0466708_110857 3300042652 Bacteria 17356
94 Ga0466727_058290 3300042655 Bacteria 2959
95 Ga0123356_10189576 3300010049 Bacteria 2086
96 Ga0123353_10458081 3300010167 Bacteria 1875
97 Ga0466705_184015 3300042612 Bacteria 7444
98 JGI24702J35022_10000370 3300002462 Bacteria 26677
99 Ga0466716_199747 3300042605 Bacteria 4644
100 Ga0466716_517262 3300042605 Bacteria 4059
101 Ga0466719_184325 3300042606 Unclassified 9074
102 Ga0466722_240313 3300042609 Bacteria 4693
103 Ga0466696_142612 3300042596 Bacteria 4508
104 Ga0466703_015135 3300042636 Bacteria 49157
105 Ga0466704_426951 3300042643 Bacteria 34972
106 Ga0466708_234738 3300042652 Bacteria 19411
107 JGI24695J34938_10001312 3300002450 Bacteria 21662
108 JGI24695J34938_10005234 3300002450 Bacteria 8177
109 Ga0466716_091524 3300042605 Bacteria 16263
110 Ga0466719_483653 3300042606 Bacteria 4077
111 Ga0466720_091377 3300042607 Bacteria 7368
112 Ga0466722_100074 3300042609 Bacteria 6920
113 Ga0466694_286953 3300042594 Bacteria 41499
114 Ga0466696_304174 3300042596 Bacteria 1725
115 Ga0466715_138125 3300042616 Bacteria 8210
116 Ga0466729_172903 3300042621 Bacteria 1888
117 Ga0466703_024587 3300042636 Bacteria 6305
118 Ga0466709_231941 3300042648 Bacteria 3435
119 Ga0466727_300064 3300042655 Bacteria 10337
120 Ga0123353_10197639 3300010167 Bacteria 3168

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_047819 Ga0466718_047819_19_1011 330
2 3300024493 Ga0264413_101090 Ga0264413_1010904 406
3 3300042596 Ga0466696_304174 Ga0466696_304174_22_1302 426
4 3300042607 Ga0466720_091377 Ga0466720_091377_5885_7222 445
5 3300042652 Ga0466708_208309 Ga0466708_208309_5254_6603 449
6 3300042616 Ga0466715_189786 Ga0466715_189786_10_1362 450
7 3300042609 Ga0466722_075258 Ga0466722_075258_9442_10809 455
8 3300042624 Ga0466735_133724 Ga0466735_133724_13_1380 455
9 3300042655 Ga0466727_154496 Ga0466727_154496_734_2110 458
10 3300042636 Ga0466703_015135 Ga0466703_015135_42166_43626 461
11 3300042596 Ga0466696_231711 Ga0466696_231711_4284_5672 462
12 3300042643 Ga0466704_401846 Ga0466704_401846_1870_3321 463
13 3300042616 Ga0466715_177257 Ga0466715_177257_2509_3903 464
14 3300042596 Ga0466696_142612 Ga0466696_142612_2913_4313 466
15 3300042620 Ga0466728_118578 Ga0466728_118578_2502_3965 466
16 3300010167 Ga0123353_10021612 Ga0123353_100216128 468
17 3300042605 Ga0466716_091524 Ga0466716_091524_13869_15302 468
18 3300042605 Ga0466716_517262 Ga0466716_517262_690_2096 468
19 3300042609 Ga0466722_202638 Ga0466722_202638_32897_34303 468
20 3300042616 Ga0466715_189366 Ga0466715_189366_6216_7622 468
21 3300042620 Ga0466728_157294 Ga0466728_157294_8531_9937 468
22 3300042652 Ga0466708_110857 Ga0466708_110857_1734_3140 468
23 3300042652 Ga0466708_416996 Ga0466708_416996_2270_3676 468
24 3300042609 Ga0466722_123343 Ga0466722_123343_17917_19365 469
25 3300042652 Ga0466708_173976 Ga0466708_173976_4065_5555 470
26 3300042655 Ga0466727_058290 Ga0466727_058290_861_2273 470
27 3300042590 Ga0466690_029331 Ga0466690_029331_4222_5673 471
28 3300042618 Ga0466723_198636 Ga0466723_198636_27745_29178 471
29 3300042619 Ga0466726_417747 Ga0466726_417747_365_1855 472
30 3300042595 Ga0466695_366562 Ga0466695_366562_2227_3684 473
31 3300042607 Ga0466720_069001 Ga0466720_069001_11540_13003 473
32 3300042648 Ga0466709_396745 Ga0466709_396745_4250_5719 473
33 3300000089 AustNasuHG_c1005319 AustNasuHG_10053195 474
34 3300042609 Ga0466722_073510 Ga0466722_073510_922_2379 474
35 3300042618 Ga0466723_056839 Ga0466723_056839_1415_2863 474
36 3300042620 Ga0466728_125333 Ga0466728_125333_1120_2589 474
37 3300042612 Ga0466705_369622 Ga0466705_369622_3541_4971 476
38 3300042636 Ga0466703_097237 Ga0466703_097237_1796_3226 476
39 3300042643 Ga0466704_567552 Ga0466704_567552_5859_7289 476
40 3300042593 Ga0466691_130929 Ga0466691_130929_11770_13203 477
41 3300042597 Ga0466699_132676 Ga0466699_132676_2919_4352 477
42 3300042605 Ga0466716_076460 Ga0466716_076460_3684_5117 477
43 3300042612 Ga0466705_509521 Ga0466705_509521_374_1807 477
44 3300042621 Ga0466729_172903 Ga0466729_172903_265_1698 477
45 3300042636 Ga0466703_135593 Ga0466703_135593_6245_7714 477
46 3300042636 Ga0466703_409321 Ga0466703_409321_45289_46752 477
47 3300042643 Ga0466704_076746 Ga0466704_076746_5221_6654 477
48 iso_pr_bacteria 2781125646 2781300663 477
49 3300002450 JGI24695J34938_10000042 JGI24695J34938_1000004269 478
50 3300002450 JGI24695J34938_10005234 JGI24695J34938_100052346 478
51 3300042612 Ga0466705_089647 Ga0466705_089647_1484_2920 478
52 3300042643 Ga0466704_296077 Ga0466704_296077_1700_3136 478
53 3300042591 Ga0466692_140863 Ga0466692_140863_5926_7365 479
54 3300042591 Ga0466692_037966 Ga0466692_037966_6403_7845 480
55 3300042593 Ga0466691_019176 Ga0466691_019176_6614_8056 480
56 3300042594 Ga0466694_286953 Ga0466694_286953_3273_4736 480
57 3300042601 Ga0466707_161334 Ga0466707_161334_1356_2798 480
58 3300042606 Ga0466719_184325 Ga0466719_184325_6882_8324 480
59 3300042609 Ga0466722_240313 Ga0466722_240313_1916_3358 480
60 3300042636 Ga0466703_140559 Ga0466703_140559_20665_22107 480
61 3300042643 Ga0466704_151874 Ga0466704_151874_5449_6891 480
62 3300042590 Ga0466690_247656 Ga0466690_247656_4134_5579 481
63 3300042597 Ga0466699_438480 Ga0466699_438480_20922_22367 481
64 3300042609 Ga0466722_062343 Ga0466722_062343_6775_8220 481
65 3300042615 Ga0466711_254685 Ga0466711_254685_8729_10174 481
66 3300042619 Ga0466726_030734 Ga0466726_030734_260_1705 481
67 3300042605 Ga0466716_199747 Ga0466716_199747_2190_3638 482
68 3300042609 Ga0466722_100074 Ga0466722_100074_1108_2556 482
69 3300042619 Ga0466726_399508 Ga0466726_399508_227_1675 482
70 3300042652 Ga0466708_234738 Ga0466708_234738_14473_15921 482
71 iso_pr_bacteria 2781125632 2781269329 482
72 3300002450 JGI24695J34938_10000044 JGI24695J34938_1000004434 483
73 3300002462 JGI24702J35022_10000370 JGI24702J35022_1000037019 483
74 3300010049 Ga0123356_10189576 Ga0123356_101895762 483
75 3300042606 Ga0466719_199083 Ga0466719_199083_14146_15597 483
76 3300042624 Ga0466735_001466 Ga0466735_001466_148_1599 483
77 3300042648 Ga0466709_217120 Ga0466709_217120_1092_2543 483
78 3300042594 Ga0466694_220062 Ga0466694_220062_1703_3157 484
79 3300042606 Ga0466719_483653 Ga0466719_483653_1281_2735 484
80 3300042616 Ga0466715_101121 Ga0466715_101121_8497_9951 484
81 3300042616 Ga0466715_138125 Ga0466715_138125_4205_5659 484
82 3300042606 Ga0466719_276693 Ga0466719_276693_227_1684 485
83 3300042615 Ga0466711_202959 Ga0466711_202959_7104_8561 485
84 3300042636 Ga0466703_075318 Ga0466703_075318_567_2024 485
85 3300042643 Ga0466704_537964 Ga0466704_537964_599_2104 485
86 3300042648 Ga0466709_080861 Ga0466709_080861_1718_3175 485
87 3300038395 Ga0415639_074643 Ga0415639_074643_3657_5117 486
88 3300042615 Ga0466711_397261 Ga0466711_397261_2489_3949 486
89 3300024493 Ga0264413_103200 Ga0264413_1032005 487
90 3300042596 Ga0466696_012033 Ga0466696_012033_7908_9371 487
91 3300042596 Ga0466696_151220 Ga0466696_151220_10560_12023 487
92 3300042606 Ga0466719_362189 Ga0466719_362189_3346_4809 487
93 3300042612 Ga0466705_064002 Ga0466705_064002_1690_3153 487
94 3300042612 Ga0466705_105191 Ga0466705_105191_10866_12329 487
95 3300042612 Ga0466705_184015 Ga0466705_184015_3711_5174 487
96 3300042636 Ga0466703_024587 Ga0466703_024587_2912_4375 487
97 3300042643 Ga0466704_099104 Ga0466704_099104_7694_9157 487
98 3300042643 Ga0466704_409633 Ga0466704_409633_1517_2980 487
99 3300042655 Ga0466727_300064 Ga0466727_300064_8142_9605 487
100 3300005200 Ga0072940_1034580 Ga0072940_10345802 488
101 3300042648 Ga0466709_231941 Ga0466709_231941_1782_3248 488
102 3300010167 Ga0123353_10197639 Ga0123353_101976392 489
103 3300042596 Ga0466696_065148 Ga0466696_065148_1324_2793 489
104 3300042612 Ga0466705_129956 Ga0466705_129956_2666_4135 489
105 3300042620 Ga0466728_050842 Ga0466728_050842_690_2159 489
106 iso_pr_bacteria 2781125647 2781303727 489
107 3300002450 JGI24695J34938_10001312 JGI24695J34938_100013129 490
108 3300042590 Ga0466690_248693 Ga0466690_248693_1568_3040 490
109 3300042636 Ga0466703_313686 Ga0466703_313686_34625_36097 490
110 3300042655 Ga0466727_299598 Ga0466727_299598_10842_12320 492
111 iso_pr_bacteria 2781125655 2781318199 493
112 3300009826 Ga0123355_10003855 Ga0123355_1000385518 494
113 3300042596 Ga0466696_010999 Ga0466696_010999_53_1540 495
114 3300042636 Ga0466703_099313 Ga0466703_099313_1551_3038 495
115 3300042620 Ga0466728_158641 Ga0466728_158641_4066_5556 496
116 3300042643 Ga0466704_426951 Ga0466704_426951_6231_7721 496
117 3300042652 Ga0466708_135822 Ga0466708_135822_1702_3192 496
118 3300009784 Ga0123357_10057600 Ga0123357_100576004 498
119 3300010167 Ga0123353_10458081 Ga0123353_104580812 498
120 3300042619 Ga0466726_114674 Ga0466726_114674_2191_3687 498
121 3300042648 Ga0466709_040343 Ga0466709_040343_2770_4266 498
122 3300042606 Ga0466719_130425 Ga0466719_130425_455_1963 502
123 3300000089 AustNasuHG_c1004979 AustNasuHG_10049793 504
124 3300042597 Ga0466699_189430 Ga0466699_189430_98_1621 507

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17767 NAPRTase_N Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain 20 143 0.99
PF17956 NAPRTase_C Nicotinate phosphoribosyltransferase C-terminal domain 371 484 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.