Protein Family IF06487
Metagenome
Isolate
169
Members
118
Samples
121
Scaffolds
382.46
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_128864|Ga0466719_128864_4811_6133
- Length
- 440 aa
- Sequence
- MLRIVGYEMSDYAFGLSNLQNRPLSSALDFPAHSLYRFRSPRALVVGCADRGFLLECCMKDHQSVGLVAPQSARFDEAIALKSGARLPGFALTYETYGNLNAARSNAVLVCHALSGNHHVAGYYDAERKKETLGWWDNLVGPGKPLDTRRFFVVGVNNLGGCHGSTGPMSPNPETNKPYGADFPLLTVEDWVAAQARLSDHLGIHTWAAVIGGSLGGMQALEWTLAYPERVRHAIVIASTPCLSAQNIAFNEVARQAILSDPEFHGGHYYECGRDGQGVIPRSGLKLARMVGHITYLSDDQLAEKFGRRMRHGKRRFNYDVEFEIESYLRHQGDKFAETFDANTYLLTTKALDYFDPAFDYEGDLRAALARAKADFFVASFTTDWRFSPEKSREIVYALLHNGLNVSYTEIDCPAGHDSFLLADAHYHAALGAYLEGIEL
Sample Types
Isolate
28.4%
Metagenome
71.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
17.3%
Apidae
14.5%
Termitidae
11.8%
Kalotermitidae
11.8%
Unclassified
10.9%
Curculionidae
8.2%
Elmidae
7.3%
Culicidae
4.5%
Armadillidiidae
3.6%
Rhinotermitidae
2.7%
Drosophilidae
1.8%
Termopsidae
1.8%
Siricidae
0.9%
Hodotermitidae
0.9%
Trigoniulidae
0.9%
Gryllidae
0.9%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 2 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 3 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 4 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 5 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 6 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 7 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 8 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 9 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 10 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 11 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 12 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 13 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 14 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 15 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 16 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 17 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 18 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 19 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 20 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 23 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 24 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 25 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 28 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 31 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 37 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 38 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 39 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 40 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 41 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 42 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 43 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 44 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 47 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 48 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 49 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 50 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 52 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 53 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 54 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 55 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 57 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 58 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 59 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 60 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 61 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 62 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 63 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 64 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 65 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 66 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 67 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 68 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 69 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 70 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 71 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 72 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 73 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 74 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 75 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 76 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 77 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 78 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 79 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 80 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 81 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 82 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 83 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 84 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 85 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 86 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 87 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 88 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 89 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 90 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 91 | 2972038244 | Pseudomonas sp. DS1 | Isolate | Formicidae |
| 92 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 93 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 94 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 95 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 96 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 97 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 98 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 99 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 100 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 101 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 102 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 103 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 104 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 105 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 106 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 107 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 108 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 109 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 110 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 111 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 112 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 113 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 114 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 115 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 116 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 117 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 118 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466724_10215 | 3300042649 | Bacteria | 65318 |
| 2 | Ga0466708_005253 | 3300042652 | Bacteria | 11367 |
| 3 | Ga0466708_101883 | 3300042652 | Bacteria | 3476 |
| 4 | Ga0123356_10001768 | 3300010049 | Unclassified | 23565 |
| 5 | Ga0160460_101125 | 3300012845 | Bacteria | 10490 |
| 6 | Ga0160445_100850 | 3300012847 | Unclassified | 11070 |
| 7 | Ga0309901_1000016 | 3300028918 | Bacteria | 176007 |
| 8 | Ga0466722_236157 | 3300042609 | Bacteria | 6125 |
| 9 | Ga0466723_337134 | 3300042618 | Bacteria | 5012 |
| 10 | Ga0466726_305036 | 3300042619 | Bacteria | 3585 |
| 11 | Ga0466729_097262 | 3300042621 | Bacteria | 61385 |
| 12 | DPO_contig08248 | 2032320009 | Bacteria | 129472 |
| 13 | CVPL010W_10004362 | 3300002931 | Bacteria | 24757 |
| 14 | Ga0103264_1000314 | 3300007188 | Bacteria | 29752 |
| 15 | Ga0466733_086556 | 3300042659 | Bacteria | 10208 |
| 16 | Ga0466734_157922 | 3300042623 | Bacteria | 4739 |
| 17 | Ga0466708_276447 | 3300042652 | Bacteria | 29039 |
| 18 | Ga0160454_100266 | 3300012798 | Bacteria | 47035 |
| 19 | Ga0309902_000002 | 3300028910 | Bacteria | 357102 |
| 20 | Ga0466706_066179 | 3300042599 | Bacteria | 5970 |
| 21 | Ga0466719_409301 | 3300042606 | Unclassified | 3375 |
| 22 | Ga0466719_561781 | 3300042606 | Bacteria | 10656 |
| 23 | Ga0466711_246769 | 3300042615 | Bacteria | 14917 |
| 24 | Ga0466715_345425 | 3300042616 | Bacteria | 3591 |
| 25 | Ga0466728_310610 | 3300042620 | Bacteria | 38010 |
| 26 | SPBB_contig11586 | 2044078006 | Bacteria | 25276 |
| 27 | CVPL010W_10000576 | 3300002931 | Bacteria | 39949 |
| 28 | CVPL005W_1000066 | 3300002934 | Bacteria | 47403 |
| 29 | Ga0102736_1002871 | 3300007052 | Bacteria | 2629 |
| 30 | Ga0102734_1000996 | 3300007129 | Bacteria | 7241 |
| 31 | Ga0103264_1000016 | 3300007188 | Bacteria | 116870 |
| 32 | Ga0466705_043433 | 3300042612 | Bacteria | 59232 |
| 33 | Ga0466705_308297 | 3300042612 | Unclassified | 5097 |
| 34 | Ga0466704_190658 | 3300042643 | Bacteria | 2749 |
| 35 | Ga0466725_185254 | 3300042654 | Bacteria | 49476 |
| 36 | Ga0160433_100675 | 3300012846 | Bacteria | 13297 |
| 37 | Ga0160435_1000374 | 3300012857 | Bacteria | 16945 |
| 38 | Ga0466690_133511 | 3300042590 | Bacteria | 2123 |
| 39 | Ga0466692_200107 | 3300042591 | Bacteria | 9345 |
| 40 | Ga0466701_011576 | 3300042598 | Bacteria | 70760 |
| 41 | Ga0466715_021036 | 3300042616 | Bacteria | 2716 |
| 42 | Ga0466728_176263 | 3300042620 | Bacteria | 3197 |
| 43 | DPOL_contig20682 | 2035918003 | Unclassified | 10335 |
| 44 | FGTW_contig30847 | 2065487013 | Bacteria | 8638 |
| 45 | Meta3P_1004069 | 3300002464 | Unclassified | 5928 |
| 46 | Ga0102734_1002836 | 3300007129 | Bacteria | 4795 |
| 47 | Ga0103267_1000044 | 3300007190 | Bacteria | 93277 |
| 48 | Ga0466704_509137 | 3300042643 | Bacteria | 56734 |
| 49 | Ga0123355_10015726 | 3300009826 | Unclassified | 11898 |
| 50 | Ga0160453_103474 | 3300012814 | Unclassified | 3242 |
| 51 | Ga0160467_101918 | 3300012829 | Unclassified | 5970 |
| 52 | Ga0160443_100890 | 3300012848 | Unclassified | 14045 |
| 53 | Ga0160443_105465 | 3300012848 | Unclassified | 1748 |
| 54 | Ga0466657_329851 | 3300042582 | Bacteria | 24148 |
| 55 | Ga0466719_327901 | 3300042606 | Bacteria | 2579 |
| 56 | Ga0103264_1000130 | 3300007188 | Bacteria | 43283 |
| 57 | Ga0466702_384186 | 3300042635 | Bacteria | 4769 |
| 58 | Ga0466724_28145 | 3300042649 | Bacteria | 34755 |
| 59 | Ga0466708_175488 | 3300042652 | Bacteria | 9825 |
| 60 | Ga0160433_100543 | 3300012846 | Bacteria | 17000 |
| 61 | Ga0316159_10063 | 3300030930 | Bacteria | 22115 |
| 62 | Ga0466706_134450 | 3300042599 | Bacteria | 1121 |
| 63 | Ga0466722_116575 | 3300042609 | Bacteria | 15553 |
| 64 | DPOL_contig01421 | 2035918003 | Unclassified | 2433 |
| 65 | SWWA_contig31699__length_14875___numreads_1005 | 2100351016 | Bacteria | 14875 |
| 66 | Ga0072941_1027316 | 3300005201 | Bacteria | 22959 |
| 67 | Ga0103266_1000042 | 3300007067 | Bacteria | 115372 |
| 68 | Ga0102735_1000328 | 3300007080 | Bacteria | 12989 |
| 69 | Ga0103261_1001082 | 3300007083 | Bacteria | 6986 |
| 70 | Ga0104042_1120086 | 3300007130 | Unclassified | 2374 |
| 71 | Ga0103260_1000336 | 3300007139 | Unclassified | 9186 |
| 72 | Ga0466704_085681 | 3300042643 | Bacteria | 46034 |
| 73 | Ga0466704_587066 | 3300042643 | Bacteria | 1652 |
| 74 | Ga0123356_10008048 | 3300010049 | Bacteria | 10491 |
| 75 | Ga0160465_103058 | 3300012803 | Unclassified | 3251 |
| 76 | Ga0466692_203058 | 3300042591 | Bacteria | 50788 |
| 77 | Ga0466696_291348 | 3300042596 | Bacteria | 5172 |
| 78 | Ga0466719_066897 | 3300042606 | Bacteria | 2905 |
| 79 | Ga0466719_128864 | 3300042606 | Bacteria | 6500 |
| 80 | Ga0466722_244784 | 3300042609 | Bacteria | 18482 |
| 81 | Ga0466710_093215 | 3300042613 | Bacteria | 16847 |
| 82 | DPO_contig00361 | 2032320009 | Unclassified | 52788 |
| 83 | Ga0072941_1017458 | 3300005201 | Bacteria | 12817 |
| 84 | Ga0466697_147057 | 3300042611 | Bacteria | 1652 |
| 85 | Ga0466730_101139 | 3300042625 | Bacteria | 2860 |
| 86 | Ga0466703_188695 | 3300042636 | Bacteria | 10808 |
| 87 | Ga0466724_11333 | 3300042649 | Bacteria | 33466 |
| 88 | Ga0466708_251872 | 3300042652 | Bacteria | 13034 |
| 89 | Ga0466708_383301 | 3300042652 | Bacteria | 8771 |
| 90 | Ga0466727_142045 | 3300042655 | Bacteria | 8594 |
| 91 | Ga0123355_10522066 | 3300009826 | Unclassified | 1452 |
| 92 | Ga0123356_10000890 | 3300010049 | Bacteria | 33023 |
| 93 | Ga0123356_10019563 | 3300010049 | Bacteria | 6417 |
| 94 | Ga0123356_10070255 | 3300010049 | Unclassified | 3284 |
| 95 | Ga0160447_101278 | 3300012849 | Unclassified | 9926 |
| 96 | Ga0309904_1000001 | 3300029810 | Bacteria | 103432 |
| 97 | Ga0466701_063769 | 3300042598 | Bacteria | 151198 |
| 98 | Ga0466713_122667 | 3300042602 | Bacteria | 2661 |
| 99 | Ga0466719_035179 | 3300042606 | Bacteria | 1232 |
| 100 | Ga0466719_119290 | 3300042606 | Bacteria | 4505 |
| 101 | Ga0466719_214219 | 3300042606 | Unclassified | 4904 |
| 102 | Ga0466711_188327 | 3300042615 | Bacteria | 4966 |
| 103 | Ga0466711_497123 | 3300042615 | Bacteria | 7395 |
| 104 | Ga0466715_441999 | 3300042616 | Bacteria | 11101 |
| 105 | DPOL_contig00646 | 2035918003 | Bacteria | 36965 |
| 106 | CVPL010L_1000182 | 3300002932 | Bacteria | 39238 |
| 107 | Ga0103268_1000302 | 3300007192 | Unclassified | 15957 |
| 108 | Ga0466705_238634 | 3300042612 | Bacteria | 15518 |
| 109 | Ga0466725_280832 | 3300042654 | Bacteria | 4311 |
| 110 | Ga0160466_104535 | 3300012809 | Bacteria | 1988 |
| 111 | Ga0309903_100005 | 3300029809 | Bacteria | 95692 |
| 112 | Ga0466690_268980 | 3300042590 | Bacteria | 23814 |
| 113 | Ga0466691_077579 | 3300042593 | Bacteria | 3594 |
| 114 | Ga0466716_107177 | 3300042605 | Bacteria | 11894 |
| 115 | Ga0466712_162909 | 3300042614 | Bacteria | 4006 |
| 116 | Ga0466726_020902 | 3300042619 | Bacteria | 28213 |
| 117 | SPBB_contig11595 | 2044078006 | Bacteria | 21514 |
| 118 | CVPL010W_10000019 | 3300002931 | Bacteria | 85641 |
| 119 | CVPL010W_10000130 | 3300002931 | Bacteria | 58866 |
| 120 | Ga0102740_1002774 | 3300007140 | Unclassified | 3902 |
| 121 | Ga0103264_1003948 | 3300007188 | Bacteria | 16197 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00561 | Abhydrolase_1 | alpha/beta hydrolase fold | 106 | 422 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.