Protein Family IF06482

Metagenome Isolate
247 Members
97 Samples
216 Scaffolds
333.66 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_119253|Ga0466719_119253_410_1558
Length
382 aa
Sequence
VRKSLQQQRTLSPAKKQKLQLSCLQPQRNAKNRKFLFLYRTKFAIMNLATSKKHMPNVVVIGNGSWATAQMLLLTQNLETVGWFIRDEKMIDYIRRYKRNPRYLHASKLDTDKIKMSCDINSLVCDADIIIIAVPSAFCKIILGEITCNISEKFIVSTTKGIIPDEHLTLSEYMNEQFSVPFANICIISGPCHAEEIALQRLSYLTFASKKAEAAEAIAKLYKTSYVKAVISADVYGTEYGAILKNIYAVGVGICLGLGYGDNFISVFTANAHREMKRFLNESYPSKRNTSRSSYLGDLLVTCYSNFSRNRTFGTLIGKGYSPEEAIAEMKMIAEGYYAARGIYEVNKRLNISMPIAKAVYKILYTRASAAKQMELVSEVLM

📊 Sample Types

Isolate 12.6%
Metagenome 87.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 22.7%
Kalotermitidae 15.9%
Unclassified 13.6%
Culicidae 10.2%
Elmidae 9.1%
Armadillidiidae 5.7%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Passalidae 2.3%
Drosophilidae 2.3%
Blattidae 2.3%
Cambaridae 2.3%
Aphididae 1.1%
Hodotermitidae 1.1%
Hydrophilidae 1.1%
Nephropidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 238
Eukaryota 0
Viruses 1
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
3 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
4 2864836148 Arcicella rosea S00070 Isolate Elmidae
5 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
6 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
7 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
8 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
9 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
10 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
11 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
12 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
13 2882250448 Bizionia sp. APA-3 Isolate
14 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
20 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
30 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
31 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
32 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
35 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
36 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
37 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
38 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
43 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
44 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
45 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
48 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
49 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
50 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
51 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
52 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
53 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
54 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
55 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
56 2904728850 Flavobacterium sp. xlx-214 Isolate
57 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
58 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
59 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
60 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
61 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
62 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
63 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
64 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
65 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
66 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
67 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
68 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
69 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
70 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
71 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
72 3004677695 Bacteroides sp. 214 Isolate Blattidae
73 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
74 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
75 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
76 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
77 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
78 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
79 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
80 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
81 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
82 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
83 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
84 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
85 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
86 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
87 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
88 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
89 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
90 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
91 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
92 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
93 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
94 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
95 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
96 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
97 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_354906 3300042612 Bacteria 74068
2 2227303007 2225789004 Bacteria 29314
3 Ga0466734_027373 3300042623 Bacteria 1542
4 Ga0466703_195275 3300042636 Bacteria 2296
5 Ga0466708_032469 3300042652 Bacteria 7402
6 Ga0466711_228872 3300042615 Bacteria 8842
7 Ga0466711_363285 3300042615 Bacteria 32228
8 Ga0466715_562323 3300042616 Bacteria 11324
9 Ga0466723_118822 3300042618 Bacteria 5912
10 Ga0123356_10429159 3300010049 Bacteria 1466
11 Ga0123353_10092093 3300010167 Bacteria 4882
12 Ga0160471_100005 3300012812 Bacteria 554359
13 Ga0160457_1001429 3300012858 Bacteria 6591
14 Ga0265387_1003510 3300024582 Bacteria 2164
15 Ga0466690_032191 3300042590 Bacteria 15907
16 Ga0466690_104687 3300042590 Bacteria 15936
17 Ga0466690_204942 3300042590 Bacteria 4733
18 Ga0466706_023319 3300042599 Bacteria 18334
19 Ga0466714_073026 3300042603 Bacteria 5189
20 Ga0466716_130852 3300042605 Bacteria 16016
21 Ga0466722_038319 3300042609 Bacteria 8924
22 Ga0466722_184008 3300042609 Bacteria 25711
23 Ga0466697_228866 3300042611 Bacteria 1461
24 Ga0466705_284582 3300042612 Bacteria 37665
25 Ga0466705_302460 3300042612 Bacteria 17135
26 IMNBL1DRAFT_c0007409 3300000062 Bacteria 5774
27 IMNBL1DRAFT_c0029461 3300000062 Unclassified 2029
28 Ga0127649_100123 3300009460 Bacteria 51721
29 Ga0466703_004906 3300042636 Bacteria 4231
30 Ga0466715_461393 3300042616 Bacteria 12344
31 Ga0466723_031794 3300042618 Bacteria 14982
32 Ga0466723_116420 3300042618 Bacteria 13144
33 Ga0466729_170048 3300042621 Bacteria 1403
34 Ga0123356_10272131 3300010049 Bacteria 1784
35 Ga0123356_10418579 3300010049 Bacteria 1481
36 Ga0160434_100238 3300012850 Bacteria 23270
37 Ga0466696_155030 3300042596 Bacteria 8129
38 Ga0466696_313856 3300042596 Bacteria 19455
39 Ga0466707_366782 3300042601 Bacteria 1121
40 Ga0466716_176169 3300042605 Bacteria 2463
41 Ga0466733_194115 3300042659 Bacteria 4301
42 Ga0466730_052548 3300042625 Bacteria 224608
43 Ga0466703_109112 3300042636 Bacteria 13554
44 Ga0466704_075713 3300042643 Bacteria 36071
45 Ga0466708_114290 3300042652 Bacteria 2071
46 Ga0466708_341777 3300042652 Bacteria 6342
47 Ga0466727_052006 3300042655 Bacteria 13726
48 Ga0466715_052065 3300042616 Bacteria 25727
49 Ga0466723_135191 3300042618 Bacteria 23983
50 Ga0466728_196254 3300042620 Bacteria 11024
51 Ga0123356_10106989 3300010049 Bacteria 2694
52 Ga0123353_10618011 3300010167 Bacteria 1544
53 Ga0160445_106486 3300012847 Bacteria 1909
54 Ga0466692_116427 3300042591 Bacteria 133716
55 Ga0466691_091359 3300042593 Bacteria 169365
56 Ga0466706_264164 3300042599 Bacteria 10011
57 Ga0466719_393855 3300042606 Bacteria 1356
58 Ga0466722_081777 3300042609 Bacteria 6147
59 Ga0466705_333479 3300042612 Bacteria 9634
60 2227507978 2225789004 Bacteria 18685
61 JGI24702J35022_10000464 3300002462 Bacteria 24409
62 JGI24702J35022_10001572 3300002462 Bacteria 14168
63 Ga0068302_10723396 3300005071 Bacteria 1384
64 Ga0072941_1094550 3300005201 Bacteria 4466
65 Ga0104045_1019258 3300007085 Bacteria 6848
66 Ga0466735_140688 3300042624 Bacteria 1507
67 Ga0466703_279126 3300042636 Bacteria 2648
68 Ga0466709_298019 3300042648 Bacteria 16242
69 Ga0466724_27328 3300042649 Bacteria 8062
70 Ga0466708_028638 3300042652 Bacteria 17459
71 Ga0466708_183984 3300042652 Bacteria 148491
72 Ga0466712_183189 3300042614 Bacteria 1159
73 Ga0466712_286643 3300042614 Bacteria 1626
74 Ga0466711_060974 3300042615 Bacteria 3792
75 Ga0466715_022900 3300042616 Bacteria 2777
76 Ga0123356_10307093 3300010049 Bacteria 1694
77 Ga0123356_10487086 3300010049 Bacteria 1387
78 Ga0123353_10000053 3300010167 Bacteria 130089
79 Ga0123353_10043937 3300010167 Bacteria 7081
80 Ga0123353_10077811 3300010167 Bacteria 5330
81 Ga0160457_1000023 3300012858 Bacteria 328177
82 Ga0466690_184827 3300042590 Bacteria 5413
83 Ga0466690_392447 3300042590 Bacteria 51684
84 Ga0466691_088301 3300042593 Bacteria 6391
85 Ga0466691_092238 3300042593 Bacteria 7364
86 Ga0466691_139200 3300042593 Bacteria 5319
87 Ga0466696_125800 3300042596 Bacteria 19941
88 Ga0466699_415691 3300042597 Bacteria 1505
89 Ga0466716_147925 3300042605 Bacteria 1776
90 Ga0466705_020803 3300042612 Bacteria 2116
91 Ga0466705_354997 3300042612 Bacteria 11138
92 Ga0466732_123638 3300042656 Bacteria 7089
93 Ga0466733_025888 3300042659 Bacteria 28930
94 IMNBL1DRAFT_c0003058 3300000062 Bacteria 11043
95 Meta3P_1000330 3300002464 Bacteria 26448
96 Ga0104045_1002684 3300007085 Bacteria 9260
97 Ga0104048_1003010 3300007143 Unclassified 4258
98 Ga0466703_082993 3300042636 Bacteria 10133
99 Ga0466704_161992 3300042643 Bacteria 55801
100 Ga0466704_170080 3300042643 Bacteria 45113
101 Ga0466704_187057 3300042643 Bacteria 3205
102 Ga0466704_284945 3300042643 Bacteria 11635
103 Ga0466704_458751 3300042643 Bacteria 8656
104 Ga0466708_093005 3300042652 Bacteria 17156
105 Ga0466727_071596 3300042655 Bacteria 6538
106 Ga0466711_064670 3300042615 Bacteria 2878
107 Ga0466726_176697 3300042619 Bacteria 8659
108 Ga0466728_358455 3300042620 Bacteria 7911
109 Ga0123353_10016860 3300010167 Bacteria 10700
110 Ga0123353_10524581 3300010167 Bacteria 1717
111 Ga0160444_100039 3300012841 Bacteria 198767
112 Ga0456237_0000003 3300041968 Bacteria 82299
113 Ga0466692_167919 3300042591 Bacteria 2540
114 Ga0466691_176004 3300042593 Bacteria 4603
115 Ga0466696_041797 3300042596 Bacteria 4593
116 Ga0466706_035751 3300042599 Bacteria 22276
117 Ga0466714_011913 3300042603 Bacteria 9635
118 Ga0466716_280499 3300042605 Bacteria 3139
119 Ga0466716_436623 3300042605 Bacteria 1484
120 Ga0466719_065159 3300042606 Bacteria 5312
121 Ga0466722_035543 3300042609 Bacteria 116913
122 Ga0466698_301493 3300042610 Bacteria 1842
123 Ga0466705_247104 3300042612 Bacteria 4076
124 Ga0466705_307412 3300042612 Bacteria 11817
125 Ga0466705_313639 3300042612 Bacteria 1097
126 Ga0466705_368539 3300042612 Bacteria 6611
127 Ga0466732_256012 3300042656 Bacteria 96394
128 IMNBL1DRAFT_c0006336 3300000062 Bacteria 6486
129 Ga0068302_10087696 3300005071 Bacteria 4044
130 Ga0466734_032741 3300042623 Bacteria 6526
131 Ga0466703_407258 3300042636 Bacteria 17762
132 Ga0466709_303647 3300042648 Bacteria 5021
133 Ga0466724_25433 3300042649 Bacteria 649431
134 Ga0466727_129558 3300042655 Unclassified 2819
135 Ga0466727_343646 3300042655 Bacteria 23959
136 Ga0466710_039573 3300042613 Bacteria 4304
137 Ga0466711_234499 3300042615 Bacteria 6630
138 Ga0466715_042305 3300042616 Bacteria 3619
139 Ga0466715_148878 3300042616 Bacteria 20966
140 Ga0466723_275212 3300042618 Unclassified 5573
141 Ga0466726_157806 3300042619 Bacteria 1195
142 Ga0466726_408199 3300042619 Bacteria 2384
143 Ga0466728_078118 3300042620 Bacteria 48135
144 Ga0466728_484929 3300042620 Bacteria 2802
145 Ga0160455_100494 3300012837 Bacteria 19654
146 Ga0466690_095436 3300042590 Bacteria 11845
147 Ga0466690_210093 3300042590 Bacteria 5283
148 Ga0466696_438911 3300042596 Bacteria 14933
149 Ga0466706_016322 3300042599 Bacteria 10637
150 Ga0466706_143789 3300042599 Bacteria 7590
151 Ga0466706_145083 3300042599 Bacteria 1589
152 Ga0466713_015196 3300042602 Bacteria 51519
153 Ga0466716_171732 3300042605 Bacteria 8434
154 Ga0466716_207367 3300042605 Bacteria 8023
155 Ga0466722_078029 3300042609 Bacteria 11440
156 Ga0466705_165701 3300042612 Bacteria 13079
157 Ga0466732_018550 3300042656 Bacteria 1496
158 Ga0466733_111595 3300042659 Bacteria 3474
159 Ga0466733_111961 3300042659 Bacteria 105531
160 IMNBL1DRAFT_c0000072 3300000062 Bacteria 91151
161 IMNBL1DRAFT_c0003089 3300000062 Bacteria 10984
162 JGI24705J35276_12226162 3300002504 Bacteria 2818
163 Ga0068302_10035943 3300005071 Unclassified 1266
164 Ga0466703_142800 3300042636 Unclassified 3797
165 Ga0466704_129076 3300042643 Bacteria 3316
166 Ga0466724_28977 3300042649 Bacteria 85636
167 Ga0466708_210002 3300042652 Bacteria 14137
168 Ga0466708_368937 3300042652 Bacteria 9431
169 Ga0466725_002982 3300042654 Bacteria 58295
170 Ga0466715_136719 3300042616 Bacteria 4927
171 Ga0466723_264066 3300042618 Bacteria 8148
172 Ga0466723_304001 3300042618 Bacteria 3642
173 Ga0466726_155137 3300042619 Bacteria 1423
174 Ga0466728_279823 3300042620 Bacteria 34589
175 Ga0466729_107623 3300042621 Bacteria 1579
176 Ga0123353_10470921 3300010167 Bacteria 1842
177 Ga0160454_100005 3300012798 Bacteria 435562
178 Ga0160453_100177 3300012814 Bacteria 62248
179 Ga0160453_100300 3300012814 Bacteria 44287
180 Ga0160467_100534 3300012829 Unclassified 35316
181 Ga0160452_101948 3300012834 Bacteria 5017
182 Ga0466690_228321 3300042590 Bacteria 5873
183 Ga0466692_141318 3300042591 Bacteria 2121
184 Ga0466691_076353 3300042593 Bacteria 10943
185 Ga0466691_184606 3300042593 Bacteria 4553
186 Ga0466696_112857 3300042596 Bacteria 4529
187 Ga0466701_048008 3300042598 Bacteria 204591
188 Ga0466714_154969 3300042603 Bacteria 4612
189 Ga0466717_030877 3300042604 Bacteria 1223
190 Ga0466721_178363 3300042608 Bacteria 3217
191 Ga0466733_212341 3300042659 Bacteria 2205
192 Ga0068305_10002946 3300005083 Bacteria 63588
193 Ga0072941_1578842 3300005201 Bacteria 1118
194 Ga0466735_064485 3300042624 Bacteria 1029
195 Ga0466703_238997 3300042636 Bacteria 1262
196 Ga0466709_143996 3300042648 Bacteria 5710
197 Ga0466708_245860 3300042652 Unclassified 1945
198 Ga0466708_307594 3300042652 Bacteria 4743
199 Ga0466708_397897 3300042652 Bacteria 54943
200 Ga0466710_409629 3300042613 Bacteria 1309
201 Ga0466711_452131 3300042615 Bacteria 22380
202 Ga0466715_419506 3300042616 Bacteria 2720
203 Ga0466723_271752 3300042618 Bacteria 1986
204 Ga0466728_027424 3300042620 Bacteria 16928
205 Ga0466728_054337 3300042620 Viruses 4954
206 Ga0466729_105197 3300042621 Bacteria 5358
207 Ga0123354_10016258 3300010882 Bacteria 11658
208 Ga0160460_100068 3300012845 Bacteria 160857
209 Ga0160448_100530 3300012854 Bacteria 13028
210 Ga0466692_126058 3300042591 Bacteria 3837
211 Ga0466696_112737 3300042596 Bacteria 8023
212 Ga0466706_025174 3300042599 Bacteria 118676
213 Ga0466719_119253 3300042606 Bacteria 3682
214 Ga0466719_495200 3300042606 Bacteria 1517
215 Ga0466722_097757 3300042609 Bacteria 5004
216 Ga0466722_159367 3300042609 Bacteria 5918

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042613 Ga0466710_409629 Ga0466710_409629_449_1276 275
2 3300042624 Ga0466735_064485 Ga0466735_064485_121_996 291
3 3300042604 Ga0466717_030877 Ga0466717_030877_64_981 305
4 3300005083 Ga0068305_10002946 Ga0068305_1000294613 307
5 3300012834 Ga0160452_101948 Ga0160452_1019484 308
6 3300042610 Ga0466698_301493 Ga0466698_301493_538_1521 311
7 3300042652 Ga0466708_210002 Ga0466708_210002_1141_2076 311
8 3300042599 Ga0466706_264164 Ga0466706_264164_3928_4866 312
9 3300042596 Ga0466696_041797 Ga0466696_041797_1110_2054 314
10 3300042596 Ga0466696_112737 Ga0466696_112737_2013_2957 314
11 3300042612 Ga0466705_368539 Ga0466705_368539_3795_4739 314
12 3300042636 Ga0466703_142800 Ga0466703_142800_690_1634 314
13 3300042652 Ga0466708_114290 Ga0466708_114290_159_1103 314
14 3300042652 Ga0466708_245860 Ga0466708_245860_32_976 314
15 3300012841 Ga0160444_100039 Ga0160444_10003954 316
16 3300010167 Ga0123353_10016860 Ga0123353_100168606 317
17 3300007085 Ga0104045_1002684 Ga0104045_100268412 319
18 3300042620 Ga0466728_279823 Ga0466728_279823_578_1576 319
19 3300000062 IMNBL1DRAFT_c0003058 IMNBL1DRAFT_00030585 322
20 3300024582 Ga0265387_1003510 Ga0265387_10035102 322
21 3300042605 Ga0466716_147925 Ga0466716_147925_479_1447 322
22 3300042618 Ga0466723_135191 Ga0466723_135191_14883_15902 322
23 3300042620 Ga0466728_078118 Ga0466728_078118_38888_39856 322
24 3300042648 Ga0466709_298019 Ga0466709_298019_8608_9576 322
25 3300042655 Ga0466727_052006 Ga0466727_052006_8245_9264 322
26 3300042603 Ga0466714_154969 Ga0466714_154969_3365_4336 323
27 3300042615 Ga0466711_228872 Ga0466711_228872_6709_7725 323
28 3300042652 Ga0466708_341777 Ga0466708_341777_1469_2488 323
29 3300005071 Ga0068302_10087696 Ga0068302_100876963 324
30 3300042605 Ga0466716_171732 Ga0466716_171732_6835_7848 324
31 3300042612 Ga0466705_307412 Ga0466705_307412_3759_4733 324
32 3300042616 Ga0466715_419506 Ga0466715_419506_568_1542 324
33 3300042618 Ga0466723_275212 Ga0466723_275212_4014_4988 324
34 3300042620 Ga0466728_358455 Ga0466728_358455_2140_3114 324
35 3300042636 Ga0466703_238997 Ga0466703_238997_172_1146 324
36 3300042649 Ga0466724_27328 Ga0466724_27328_4617_5591 324
37 3300042652 Ga0466708_183984 Ga0466708_183984_58737_59711 324
38 3300010049 Ga0123356_10307093 Ga0123356_103070932 325
39 3300042609 Ga0466722_184008 Ga0466722_184008_24195_25190 326
40 3300010882 Ga0123354_10016258 Ga0123354_100162582 327
41 3300042596 Ga0466696_313856 Ga0466696_313856_7673_8656 327
42 3300042615 Ga0466711_234499 Ga0466711_234499_5282_6265 327
43 3300042616 Ga0466715_562323 Ga0466715_562323_7082_8065 327
44 3300042619 Ga0466726_176697 Ga0466726_176697_5607_6590 327
45 3300042643 Ga0466704_075713 Ga0466704_075713_14818_15801 327
46 3300042652 Ga0466708_032469 Ga0466708_032469_3440_4423 327
47 3300042656 Ga0466732_018550 Ga0466732_018550_244_1227 327
48 3300042659 Ga0466733_025888 Ga0466733_025888_7394_8377 327
49 3300042659 Ga0466733_194115 Ga0466733_194115_781_1764 327
50 3300002462 JGI24702J35022_10001572 JGI24702J35022_100015727 328
51 3300002504 JGI24705J35276_12226162 JGI24705J35276_122261622 328
52 3300010049 Ga0123356_10106989 Ga0123356_101069892 328
53 3300010049 Ga0123356_10418579 Ga0123356_104185791 328
54 3300010167 Ga0123353_10043937 Ga0123353_100439375 328
55 3300010167 Ga0123353_10092093 Ga0123353_100920934 328
56 3300010167 Ga0123353_10470921 Ga0123353_104709212 328
57 3300010167 Ga0123353_10618011 Ga0123353_106180112 328
58 3300042603 Ga0466714_073026 Ga0466714_073026_3869_4855 328
59 iso_pr_bacteria 2820789850 2820791818 328
60 3300042599 Ga0466706_035751 Ga0466706_035751_12843_13832 329
61 3300042656 Ga0466732_256012 Ga0466732_256012_49971_50960 329
62 3300010049 Ga0123356_10429159 Ga0123356_104291592 330
63 3300041968 Ga0456237_0000003 Ga0456237_0000003_16825_17820 331
64 3300042590 Ga0466690_392447 Ga0466690_392447_30689_31684 331
65 3300042591 Ga0466692_116427 Ga0466692_116427_77738_78733 331
66 3300042599 Ga0466706_016322 Ga0466706_016322_5800_6795 331
67 3300042599 Ga0466706_023319 Ga0466706_023319_13874_14869 331
68 3300042609 Ga0466722_035543 Ga0466722_035543_60092_61087 331
69 3300042609 Ga0466722_097757 Ga0466722_097757_2039_3034 331
70 3300042612 Ga0466705_247104 Ga0466705_247104_2026_3021 331
71 3300042618 Ga0466723_271752 Ga0466723_271752_941_1936 331
72 3300042620 Ga0466728_196254 Ga0466728_196254_7612_8607 331
73 3300042624 Ga0466735_140688 Ga0466735_140688_136_1131 331
74 3300042636 Ga0466703_407258 Ga0466703_407258_14981_15976 331
75 3300042643 Ga0466704_187057 Ga0466704_187057_591_1586 331
76 3300042652 Ga0466708_028638 Ga0466708_028638_4314_5309 331
77 3300042659 Ga0466733_111595 Ga0466733_111595_1331_2326 331
78 iso_pr_bacteria 2838772460 2838774118 331
79 iso_pr_bacteria 3004677695 3004678131 331
80 iso_pr_bacteria 643348524 643423296 331
81 3300000062 IMNBL1DRAFT_c0003089 IMNBL1DRAFT_00030893 332
82 3300042599 Ga0466706_025174 Ga0466706_025174_49305_50303 332
83 3300042605 Ga0466716_130852 Ga0466716_130852_451_1449 332
84 3300042612 Ga0466705_302460 Ga0466705_302460_2059_3057 332
85 3300042643 Ga0466704_129076 Ga0466704_129076_911_1909 332
86 3300042659 Ga0466733_111961 Ga0466733_111961_81498_82496 332
87 iso_pr_bacteria 2873776654 2873777770 332
88 3300012812 Ga0160471_100005 Ga0160471_100005257 333
89 3300012814 Ga0160453_100177 Ga0160453_1001779 333
90 3300012814 Ga0160453_100300 Ga0160453_10030026 333
91 3300012845 Ga0160460_100068 Ga0160460_10006889 333
92 3300012847 Ga0160445_106486 Ga0160445_1064862 333
93 3300012850 Ga0160434_100238 Ga0160434_10023810 333
94 3300012858 Ga0160457_1000023 Ga0160457_10000237 333
95 3300012858 Ga0160457_1001429 Ga0160457_10014295 333
96 3300042593 Ga0466691_176004 Ga0466691_176004_671_1672 333
97 3300042596 Ga0466696_112857 Ga0466696_112857_2446_3447 333
98 3300042599 Ga0466706_143789 Ga0466706_143789_6132_7133 333
99 3300042599 Ga0466706_145083 Ga0466706_145083_503_1504 333
100 3300042615 Ga0466711_060974 Ga0466711_060974_346_1347 333
101 3300042652 Ga0466708_397897 Ga0466708_397897_27429_28430 333
102 3300042656 Ga0466732_123638 Ga0466732_123638_2060_3061 333
103 iso_pr_bacteria 2882250448 2882250590 333
104 iso_pr_bacteria 2910959314 2910961417 333
105 3300042602 Ga0466713_015196 Ga0466713_015196_35038_36042 334
106 3300042603 Ga0466714_011913 Ga0466714_011913_456_1460 334
107 3300042612 Ga0466705_020803 Ga0466705_020803_1028_2032 334
108 3300042614 Ga0466712_183189 Ga0466712_183189_101_1105 334
109 3300042659 Ga0466733_212341 Ga0466733_212341_563_1567 334
110 3300000062 IMNBL1DRAFT_c0006336 IMNBL1DRAFT_00063362 335
111 3300012798 Ga0160454_100005 Ga0160454_100005347 335
112 3300012829 Ga0160467_100534 Ga0160467_10053422 335
113 3300042590 Ga0466690_204942 Ga0466690_204942_317_1324 335
114 3300042591 Ga0466692_126058 Ga0466692_126058_2060_3067 335
115 3300042591 Ga0466692_167919 Ga0466692_167919_54_1061 335
116 3300042593 Ga0466691_088301 Ga0466691_088301_2659_3666 335
117 3300042605 Ga0466716_280499 Ga0466716_280499_336_1343 335
118 3300042615 Ga0466711_064670 Ga0466711_064670_1857_2864 335
119 3300042615 Ga0466711_452131 Ga0466711_452131_20208_21215 335
120 3300042618 Ga0466723_116420 Ga0466723_116420_2933_3940 335
121 3300042619 Ga0466726_155137 Ga0466726_155137_362_1369 335
122 3300042620 Ga0466728_027424 Ga0466728_027424_9627_10634 335
123 iso_pr_bacteria 2718218155 2720328216 335
124 iso_pr_bacteria 2820768849 2820769967 335
125 iso_pr_bacteria 2820774381 2820775301 335
126 iso_pr_bacteria 2998929858 2998930016 335
127 3300009460 Ga0127649_100123 Ga0127649_1001234 336
128 3300010167 Ga0123353_10000053 Ga0123353_1000005346 336
129 3300010167 Ga0123353_10524581 Ga0123353_105245811 336
130 3300042612 Ga0466705_284582 Ga0466705_284582_3950_4960 336
131 3300042623 Ga0466734_032741 Ga0466734_032741_48_1076 336
132 3300042649 Ga0466724_25433 Ga0466724_25433_373914_374924 336
133 iso_pr_bacteria 2529292732 2529758641 336
134 iso_pr_bacteria 2847090942 2847094531 336
135 iso_pr_bacteria 2864788197 2864791839 336
136 iso_pr_bacteria 2864923010 2864926652 336
137 iso_pr_bacteria 2864948220 2864951861 336
138 iso_pr_bacteria 8020009074 8020011859 336
139 iso_pr_bacteria 8114076984 8114080194 336
140 2225789004 2227303007 2227753117 337
141 2225789004 2227507978 2227999283 337
142 3300002464 Meta3P_1000330 Meta3P_100033015 337
143 3300007085 Ga0104045_1019258 Ga0104045_10192582 337
144 3300007143 Ga0104048_1003010 Ga0104048_10030102 337
145 3300012837 Ga0160455_100494 Ga0160455_10049417 337
146 3300042590 Ga0466690_184827 Ga0466690_184827_438_1451 337
147 3300042590 Ga0466690_210093 Ga0466690_210093_2531_3544 337
148 3300042593 Ga0466691_076353 Ga0466691_076353_6322_7335 337
149 3300042606 Ga0466719_393855 Ga0466719_393855_117_1130 337
150 3300042609 Ga0466722_038319 Ga0466722_038319_3858_4871 337
151 3300042609 Ga0466722_081777 Ga0466722_081777_2390_3403 337
152 3300042612 Ga0466705_165701 Ga0466705_165701_3044_4057 337
153 3300042612 Ga0466705_354997 Ga0466705_354997_1728_2741 337
154 3300042615 Ga0466711_363285 Ga0466711_363285_14795_15808 337
155 3300042616 Ga0466715_148878 Ga0466715_148878_1392_2405 337
156 3300042618 Ga0466723_304001 Ga0466723_304001_2607_3620 337
157 3300042620 Ga0466728_484929 Ga0466728_484929_95_1108 337
158 3300042621 Ga0466729_105197 Ga0466729_105197_1972_2985 337
159 3300042621 Ga0466729_170048 Ga0466729_170048_317_1330 337
160 3300042636 Ga0466703_004906 Ga0466703_004906_2002_3015 337
161 3300042636 Ga0466703_279126 Ga0466703_279126_1615_2628 337
162 3300042643 Ga0466704_161992 Ga0466704_161992_28806_29819 337
163 3300042643 Ga0466704_170080 Ga0466704_170080_9460_10473 337
164 3300042648 Ga0466709_303647 Ga0466709_303647_1330_2343 337
165 3300042652 Ga0466708_093005 Ga0466708_093005_12800_13813 337
166 3300042655 Ga0466727_071596 Ga0466727_071596_2836_3849 337
167 iso_pr_bacteria 2820748953 2820749607 337
168 iso_pr_bacteria 2820772500 2820773126 337
169 3300000062 IMNBL1DRAFT_c0000072 IMNBL1DRAFT_000007256 338
170 3300000062 IMNBL1DRAFT_c0029461 IMNBL1DRAFT_00294612 338
171 3300005071 Ga0068302_10723396 Ga0068302_107233962 338
172 3300005201 Ga0072941_1578842 Ga0072941_15788421 338
173 3300010049 Ga0123356_10487086 Ga0123356_104870862 338
174 3300042593 Ga0466691_091359 Ga0466691_091359_124734_125750 338
175 3300042596 Ga0466696_155030 Ga0466696_155030_4976_5992 338
176 3300042608 Ga0466721_178363 Ga0466721_178363_713_1729 338
177 3300042609 Ga0466722_159367 Ga0466722_159367_164_1180 338
178 3300042613 Ga0466710_039573 Ga0466710_039573_3131_4147 338
179 3300042616 Ga0466715_461393 Ga0466715_461393_7484_8500 338
180 iso_pr_bacteria 2904728850 2904730681 338
181 iso_pr_bacteria 2958471994 2958473492 338
182 3300000062 IMNBL1DRAFT_c0007409 IMNBL1DRAFT_00074092 339
183 3300042590 Ga0466690_032191 Ga0466690_032191_7291_8310 339
184 3300042590 Ga0466690_095436 Ga0466690_095436_6005_7024 339
185 3300042590 Ga0466690_104687 Ga0466690_104687_1446_2465 339
186 3300042590 Ga0466690_228321 Ga0466690_228321_1442_2461 339
187 3300042593 Ga0466691_139200 Ga0466691_139200_3034_4053 339
188 3300042593 Ga0466691_184606 Ga0466691_184606_2206_3225 339
189 3300042596 Ga0466696_125800 Ga0466696_125800_18314_19333 339
190 3300042597 Ga0466699_415691 Ga0466699_415691_374_1393 339
191 3300042605 Ga0466716_176169 Ga0466716_176169_601_1620 339
192 3300042605 Ga0466716_207367 Ga0466716_207367_3828_4847 339
193 3300042605 Ga0466716_436623 Ga0466716_436623_16_1035 339
194 3300042606 Ga0466719_065159 Ga0466719_065159_2007_3026 339
195 3300042606 Ga0466719_495200 Ga0466719_495200_154_1173 339
196 3300042614 Ga0466712_286643 Ga0466712_286643_494_1513 339
197 3300042616 Ga0466715_022900 Ga0466715_022900_949_1968 339
198 3300042616 Ga0466715_042305 Ga0466715_042305_719_1738 339
199 3300042616 Ga0466715_052065 Ga0466715_052065_16613_17632 339
200 3300042616 Ga0466715_136719 Ga0466715_136719_3476_4495 339
201 3300042618 Ga0466723_031794 Ga0466723_031794_2559_3578 339
202 3300042618 Ga0466723_118822 Ga0466723_118822_2412_3431 339
203 3300042619 Ga0466726_408199 Ga0466726_408199_483_1502 339
204 3300042620 Ga0466728_054337 Ga0466728_054337_2532_3551 339
205 3300042636 Ga0466703_082993 Ga0466703_082993_7413_8432 339
206 3300042636 Ga0466703_109112 Ga0466703_109112_8782_9801 339
207 3300042636 Ga0466703_195275 Ga0466703_195275_52_1071 339
208 3300042643 Ga0466704_284945 Ga0466704_284945_7839_8858 339
209 3300042648 Ga0466709_143996 Ga0466709_143996_3425_4444 339
210 3300042652 Ga0466708_307594 Ga0466708_307594_2083_3102 339
211 3300042652 Ga0466708_368937 Ga0466708_368937_4501_5520 339
212 3300042655 Ga0466727_129558 Ga0466727_129558_1249_2268 339
213 3300042655 Ga0466727_343646 Ga0466727_343646_17718_18737 339
214 iso_pr_bacteria 2820736622 2820736829 339
215 iso_pr_bacteria 2820740053 2820740183 339
216 3300002462 JGI24702J35022_10000464 JGI24702J35022_100004644 340
217 3300005071 Ga0068302_10035943 Ga0068302_100359431 340
218 3300005201 Ga0072941_1094550 Ga0072941_10945505 340
219 3300010049 Ga0123356_10272131 Ga0123356_102721312 340
220 3300010167 Ga0123353_10077811 Ga0123353_100778113 340
221 3300042612 Ga0466705_313639 Ga0466705_313639_30_1052 340
222 3300042611 Ga0466697_228866 Ga0466697_228866_320_1345 341
223 iso_pr_bacteria 2864836148 2864839072 341
224 3300042612 Ga0466705_354906 Ga0466705_354906_58376_59404 342
225 3300042618 Ga0466723_264066 Ga0466723_264066_1325_2356 343
226 3300042619 Ga0466726_157806 Ga0466726_157806_92_1123 343
227 3300042654 Ga0466725_002982 Ga0466725_002982_7165_8196 343
228 3300042591 Ga0466692_141318 Ga0466692_141318_240_1274 344
229 3300042643 Ga0466704_458751 Ga0466704_458751_1988_3022 344
230 3300042593 Ga0466691_092238 Ga0466691_092238_3519_4556 345
231 3300012854 Ga0160448_100530 Ga0160448_1005302 346
232 3300042598 Ga0466701_048008 Ga0466701_048008_40645_41685 346
233 3300042601 Ga0466707_366782 Ga0466707_366782_47_1087 346
234 3300042623 Ga0466734_027373 Ga0466734_027373_317_1357 346
235 3300042649 Ga0466724_28977 Ga0466724_28977_48849_49889 346
236 iso_pr_bacteria 2864822740 2864826203 346
237 iso_pr_bacteria 2864831662 2864835605 346
238 iso_pr_bacteria 2864882932 2864886390 346
239 iso_pr_bacteria 2864891731 2864894955 346
240 iso_pr_bacteria 2921902974 2921904036 348
241 3300042612 Ga0466705_333479 Ga0466705_333479_2968_4017 349
242 3300042609 Ga0466722_078029 Ga0466722_078029_9902_10954 350
243 3300042621 Ga0466729_107623 Ga0466729_107623_500_1558 352
244 3300042625 Ga0466730_052548 Ga0466730_052548_157974_159086 370
245 iso_pr_bacteria 2687453786 2690173636 370
246 3300042596 Ga0466696_438911 Ga0466696_438911_13049_14197 382
247 3300042606 Ga0466719_119253 Ga0466719_119253_410_1558 382

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus 234 372 0.97
PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus 58 214 0.96
PF20618 GPD_NAD_C_bact Bacterial GPD, NAD-dependent C-terminal 294 360 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.