- ArthroVerse

Protein Family IF06451

Metagenome Isolate

275 Members

181 Samples

151 Scaffolds

366.87 Avg Length

🧬 Representative Sequence

ID: 3300042606|Ga0466719_032484|Ga0466719_032484_11970_13211
Length: 413 aa
Sequence: MNGTFLYPEEKNMVKMSLEHIRKVYPNQVIAAVPDYNLEIDDGEFTVFIGPSGSGKSTVLRMIAGLEDITSGEFKIGDKVMNDVEPKNRDIAMVFQNYALYPHMTVRDNMAFGLKLRKMNKEEIDTRVQKAAEMLSLEEFLDRKPANLSGGQRQRVALGRAIVRDAQVMLLDEPLSNLDAKLRVEMRSTISKLHQQLKNNMIYVTHDQIEAMTMADRIVLIDHGVIQQDGSPEELYNKPGNKFVAGFMGSPSMNLINVDVKGDKIITKDGKVSLKLPKSKSKLLKDKGYDGKEVVFGIRPEDIHTEPITKETYPGDTVNVKLDLVEPLGAETMLYFQLDNNNFVARVGSRDTSKTGENTELTFQLPNAHFFDPETEIVITNDETTYKSPTRQESDLANSKGTSLEGTKNSGKY

📊 Sample Types

Isolate 45.1%

Metagenome 54.9%

MAG 0.0%

Metatranscriptome 0.0%

Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 36.4%

Termitidae 12.7%

Apidae 10.4%

Muscidae 7.5%

Kalotermitidae 6.4%

Formicidae 4.0%

Blattidae 2.3%

Tenebrionidae 2.3%

Calliphoridae 1.7%

Culicidae 1.7%

Armadillidiidae 1.7%

Passalidae 1.7%

Rhinotermitidae 1.2%

Plutellidae 1.2%

Cerambycidae 1.2%

Termopsidae 1.2%

Ixodidae 0.6%

Acrididae 0.6%

Coreidae 0.6%

Scarabaeidae 0.6%

Hodotermitidae 0.6%

Anthomyiidae 0.6%

Noctuidae 0.6%

Elmidae 0.6%

Pyralidae 0.6%

Hydrophilidae 0.6%

Tephritidae 0.6%

🌳 Taxonomy

Archaea 0

Bacteria 252

Eukaryota 0

Viruses 0

Unclassified 23

🗂️ Samples

#	Sample ID	Description	Type	Taxa Family
1	8110340172	Bifidobacterium choladohabitans B14384H11	Isolate	Apidae
2	2862075925	Corynebacterium lactis S064	Isolate	Ixodidae
3	2865983822	Bifidobacterium xylocopae XV2	Isolate	Apidae
4	2921842437	Cronobacter sakazakii MOD1-Lc10s	Isolate	Calliphoridae
5	2957730672	Cronobacter sakazakii MOD1-Md70g	Isolate	Muscidae
6	2035265001	Acrididae gut microbial communities from Texas A and M University, USA - Sample 321	Metagenome	Acrididae
7	2511231129	Vibrio sp. EJY3	Isolate	Unclassified
8	2519899775	Bifidobacterium asteroides PRL2011	Isolate	Apidae
9	2565956518	Vibrio pacinii DSM 19139	Isolate	Unclassified
10	2597490239	Bifidobacterium bohemicum DSM 22767	Isolate	Unclassified
11	2600255074	Vibrio proteolyticus NBRC 13287	Isolate	Unclassified
12	2663763384	Bifidobacterium bombi DSM 19703	Isolate	Apidae
13	2681812870	Oerskovia enterophila DFA-19	Isolate	Unclassified
14	2711768164	Tritonibacter mobilis S1942	Isolate	Unclassified
15	2816332545	Tritonibacter mobilis S1923	Isolate	Unclassified
16	2820211246	Unclassified Kiritimatiellaeota Nt197P3bin96	Isolate	Unclassified
17	2820348946	Unclassified Firmicutes Nt197P3bin47	Isolate	Unclassified
18	3300042621	Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511	Metagenome	Rhinotermitidae
19	3300042622	Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319	Metagenome	Termitidae
20	3300042643	Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481	Metagenome	Kalotermitidae
21	3300042648	Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174	Metagenome	Kalotermitidae
22	3300042659	Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116	Metagenome	Termitidae
23	8022345672	Vibrio sp. 070316B	Isolate	Unclassified
24	8067987626	Agromyces larvae CFWR-12	Isolate	Unclassified
25	8078130113	Caballeronia sp. INDeC2	Isolate	Coreidae
26	3300042596	Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408	Metagenome	Kalotermitidae
27	3300042616	Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350	Metagenome	Kalotermitidae
28	2967915117	Cronobacter sakazakii MOD1-Lc10g	Isolate	Calliphoridae
29	3300007142	Ant gut microbial communities from Cephalotes grandinosus, Brazil	Metagenome	Formicidae
30	8110341875	Bifidobacterium polysaccharolyticum W8117	Isolate	Apidae
31	2820803007	Unclassified Actinobacteria Th196P3bin61	Isolate	Unclassified
32	2856068565	Cronobacter sakazakii MOD1-Md35s	Isolate	Muscidae
33	2896925746	Vibrio nigripulchritudo SFn27	Isolate	Unclassified
34	2609459925	Vibrio nigripulchritudo SO65	Isolate	Unclassified
35	2627853677	Vibrio nigripulchritudo FTn2	Isolate	Unclassified
36	2808606957	Bifidobacterium sp. ESL0447	Isolate	Unclassified
37	8022116796	Vibrio sp. T3Y01	Isolate	Unclassified
38	8051461712	Vibrio vulnificus Vv002	Isolate
39	8060845732	Vibrio vulnificus Vv006	Isolate
40	8064531044	Terrisporobacter mayombei DSM 6539	Isolate	Unclassified
41	3300042601	Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463	Metagenome	Unclassified
42	2967924226	Cronobacter malonaticus MOD1-Md25g	Isolate	Muscidae
43	2970322301	Cronobacter sakazakii MOD1-Md33g	Isolate	Muscidae
44	2989793055	Vibrio atypicus DSM 25292	Isolate	Unclassified
45	3300000089	Insect hindgut associated microbial communities from Australia - Nasutitermes	Metagenome	Termitidae
46	3300005083	Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial	Metagenome	Unclassified
47	3300007188	Ant gut microbial communities from Cephalotes rohweri, Arizona, USA	Metagenome	Formicidae
48	3300012835	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG	Metagenome	Culicidae
49	3300012849	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG	Metagenome	Culicidae
50	3300035363	Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut	Metagenome	Plutellidae
51	2820901319	Unclassified Actinobacteria Emb289P4bin58	Isolate	Unclassified
52	2884613238	Agromyces intestinalis KACC 19306	Isolate	Scarabaeidae
53	2912636047	Vibrio crassostreae 9CS106	Isolate	Unclassified
54	2940264388	Lachnospiraceae bacterium PFB1-17	Isolate	Blattidae
55	2940267548	Lachnospiraceae bacterium PFB1-22	Isolate	Blattidae
56	2065487013	Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm	Metagenome
57	2504756063	Isoptericola variabilis J5	Isolate	Unclassified
58	2597490194	Bifidobacterium coryneforme LMG 18911	Isolate	Apidae
59	2609459958	Vibrio nigripulchritudo Wn13	Isolate	Unclassified
60	2630968716	Vibrio nigripulchritudo AM115	Isolate	Unclassified
61	2636415542	Vibrio nigripulchritudo SFn135	Isolate	Unclassified
62	2671180601	Bifidobacterium asteroides DSM 20089	Isolate	Unclassified
63	2820546020	Unclassified Firmicutes Lab288P1bin102	Isolate	Unclassified
64	3300042625	Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363	Metagenome	Termitidae
65	3300042652	Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510	Metagenome	Kalotermitidae
66	3300042654	Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449	Metagenome	Termitidae
67	3300042591	Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509	Metagenome	Rhinotermitidae
68	3300042599	Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464	Metagenome	Hodotermitidae
69	3300042603	Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356	Metagenome	Termitidae
70	3300042618	Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387	Metagenome	Kalotermitidae
71	2977691992	Cronobacter malonaticus MOD1-Md27g	Isolate	Muscidae
72	2977745872	Cronobacter sakazakii MOD1-Md1g	Isolate	Muscidae
73	3300002931	Ant worker gut metagenome for colony PL010	Metagenome	Formicidae
74	3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Metagenome	Termitidae
75	3300010167	Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3	Metagenome	Termitidae
76	3300010882	Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4	Metagenome	Termitidae
77	2820845766	Unclassified Actinobacteria Lab288P3bin96	Isolate	Unclassified
78	2820922474	Unclassified Actinobacteria Emb289P3bin154	Isolate	Unclassified
79	2820926697	Unclassified Actinobacteria Emb289P3bin125	Isolate	Unclassified
80	2865982043	Bifidobacterium aemilianum XV10	Isolate	Apidae
81	2921816052	Cronobacter sakazakii MOD1-Anth48g	Isolate	Anthomyiidae
82	2937427229	Cronobacter malonaticus MOD1-Md99g	Isolate	Muscidae
83	2505679068	Isoptericola variabilis 225	Isolate	Unclassified
84	2513237174	Bifidobacterium asteroides ATCC 25910	Isolate	Apidae
85	2551306516	Enterobacter hormaechei YT3	Isolate	Tenebrionidae
86	2627854002	Vibrio nigripulchritudo ENn2	Isolate	Unclassified
87	2645727657	Bifidobacterium actinocoloniiforme DSM 22766	Isolate	Unclassified
88	2711768158	Vibrio coralliilyticus S2043	Isolate	Unclassified
89	2816332503	Tritonibacter mobilis S1611	Isolate	Unclassified
90	2820492969	Unclassified Firmicutes Lab288P1bin6	Isolate	Unclassified
91	2820516196	Unclassified Firmicutes Lab288P1bin3	Isolate	Unclassified
92	3300042636	Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477	Metagenome	Kalotermitidae
93	3300042649	Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381	Metagenome	Termitidae
94	3300042592	Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333	Metagenome	Termitidae
95	3300042598	Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382	Metagenome	Termitidae
96	3300042611	Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372	Metagenome	Termitidae
97	3300042615	Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353	Metagenome	Kalotermitidae
98	3300002462	Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4	Metagenome	Termitidae
99	3300012846	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG	Metagenome	Armadillidiidae
100	2820894511	Unclassified Actinobacteria Lab288P1bin103	Isolate	Unclassified
101	2876334352	Cronobacter sakazakii MOD1-Md6g	Isolate	Muscidae
102	2883361506	Luteimicrobium xylanilyticum HY-24	Isolate	Cerambycidae
103	2648501158	Vibrio hepatarius DSM 19134	Isolate	Unclassified
104	2660238275	Bifidobacterium indicum DSM 20214	Isolate	Unclassified
105	2684622916	Bifidobacterium asteroides Bi_170	Isolate	Unclassified
106	2684622917	Bifidobacterium coryneforme Bi_197	Isolate	Unclassified
107	2693429521	Bifidobacterium coryneforme DSM 20216	Isolate	Unclassified
108	2718218026	Phaeobacter porticola P97	Isolate	Unclassified
109	2788500098	Bombiscardovia coagulans DSM 22924	Isolate	Apidae
110	2820600392	Unclassified Firmicutes Emb289P1bin52	Isolate	Unclassified
111	3300042623	Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448	Metagenome	Termitidae
112	8024982947	Bifidobacterium asteroides ESL0200	Isolate	Apidae
113	8051551332	Vibrio vulnificus Vv003	Isolate
114	3300002932	Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010	Metagenome	Formicidae
115	3300005721	Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176	Metagenome	Apidae
116	3300007068	Ant gut microbial communities from Cephalotes simillimus, Peru	Metagenome	Formicidae
117	3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Metagenome	Termitidae
118	2876358570	Cronobacter sakazakii MOD1-Ls15g	Isolate	Calliphoridae
119	2940273867	Lachnoclostridium sp. PH1-16	Isolate	Blattidae
120	2568526170	Bifidobacterium sp. A11	Isolate	Apidae
121	2600255079	Bifidobacterium bombi DSM 19703	Isolate	Apidae
122	2684622919	Bifidobacterium asteroides Bi_199	Isolate	Unclassified
123	2820504582	Unclassified Firmicutes Lab288P1bin5	Isolate	Unclassified
124	3300042655	Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454	Metagenome	Termopsidae
125	8024986378	Bifidobacterium asteroides ESL0198	Isolate	Apidae
126	8032009961	Bifidobacterium indicum ESL0197	Isolate	Apidae
127	3300042593	Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354	Metagenome	Kalotermitidae
128	3300042606	Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470	Metagenome	Kalotermitidae
129	3300042619	Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218	Metagenome	Termopsidae
130	3300002501	Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1	Metagenome	Termitidae
131	3300002504	Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4	Metagenome	Termitidae
132	3300012814	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG	Metagenome
133	3300030930	Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554	Metagenome	Formicidae
134	3300003097	Cutworm gut microbial communities from Hangzhou, China	Metagenome	Noctuidae
135	2820867525	Unclassified Actinobacteria Lab288P3bin128	Isolate	Unclassified
136	2833053935	Buttiauxella sp. 3AFRM03	Isolate	Cerambycidae
137	2864816158	Priestia aryabhattai S00060	Isolate	Elmidae
138	2879643867	Bifidobacterium sp. wkB344	Isolate	Apidae
139	2884351759	Cellulosimicrobium sp. BI34T	Isolate	Pyralidae
140	2940270707	Lachnoclostridium sp. PF1-13	Isolate	Blattidae
141	2225789004	Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL)	Metagenome	Passalidae
142	2551306531	Enterobacter hormaechei YT2	Isolate	Tenebrionidae
143	2648501820	Vibrio nigripulchritudo BLFn1	Isolate	Unclassified
144	2684622920	Bifidobacterium asteroides Bi_200	Isolate	Unclassified
145	2802429577	Bifidobacterium indicum DSM 20214	Isolate	Unclassified
146	2820329821	Unclassified Firmicutes Nt197P3bin77	Isolate	Unclassified
147	2970335472	Cronobacter muytjensii MOD1-Md1s	Isolate	Muscidae
148	2977727922	Cronobacter sakazakii MOD1-Md33s	Isolate	Muscidae
149	3300012806	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG	Metagenome
150	3300012812	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG	Metagenome	Culicidae
151	3300012858	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG	Metagenome	Armadillidiidae
152	8116627632	Vibrio penaeicida NBRC 15640	Isolate	Unclassified
153	2822856742	Enterobacter cancerogenus CR-Eb1	Isolate	Unclassified
154	2874880541	Enterobacter hormaechei E3442	Isolate	Unclassified
155	2964846109	Cronobacter sakazakii MOD1-Md5g	Isolate	Muscidae
156	2964859436	Cronobacter sakazakii MOD1-Md40g	Isolate	Muscidae
157	2873595552	Erysipelothrix sp. HDW6C	Isolate	Hydrophilidae
158	2225789003	Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL)	Metagenome	Passalidae
159	2547132185	Enterobacter cancerogenus YZ1	Isolate	Tenebrionidae
160	2684622918	Bifidobacterium asteroides Bi_198	Isolate	Unclassified
161	2791355471	Vibrio bivalvicida 605	Isolate	Unclassified
162	2820267566	Unclassified Firmicutes Th196P3bin33	Isolate	Unclassified
163	3300056856	Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2)	Metagenome	Tenebrionidae
164	8018312681	Enterobacter sp. OLF	Isolate	Tephritidae
165	8024981139	Bifidobacterium asteroides ESL0170	Isolate	Apidae
166	8024984606	Bifidobacterium asteroides ESL0199	Isolate	Apidae
167	3300042582	Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373	Metagenome	Termitidae
168	3300042594	Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324	Metagenome	Termitidae
169	3300042600	Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436	Metagenome	Termitidae
170	3300042602	Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513	Metagenome	Unclassified
171	3300042612	Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485	Metagenome	Kalotermitidae
172	3000861951	Budvicia diplopodorum D9	Isolate
173	3004364956	Cronobacter sakazakii MOD1-Md5s	Isolate	Muscidae
174	3006225627	Vibrio sp. Hep-1b-8	Isolate	Unclassified
175	3006242587	Vibrio sp. RE86	Isolate	Unclassified
176	3300000062	Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL)	Metagenome	Passalidae
177	3300002509	Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4	Metagenome	Termitidae
178	3300007095	Ant gut microbial communities from Cephalotes minutus, Brazil	Metagenome	Formicidae
179	3300012841	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG	Metagenome	Armadillidiidae
180	3300012852	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG	Metagenome
181	3300035364	Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut	Metagenome	Plutellidae

🔗 Scaffolds

#	Scaffold	Sample	Taxonomy	Length
1	Ga0466733_202421	3300042659	Bacteria	16584
2	Ga0466711_088734	3300042615	Bacteria	1655
3	Ga0466715_091559	3300042616	Bacteria	14413
4	Ga0466715_205939	3300042616	Bacteria	12555
5	Ga0123355_10002644	3300009826	Bacteria	25433
6	Ga0123356_10010394	3300010049	Bacteria	9135
7	Ga0123353_10092479	3300010167	Bacteria	4873
8	Ga0123353_10242621	3300010167	Bacteria	2798
9	Ga0160457_1000020	3300012858	Bacteria	357225
10	Ga0466707_405810	3300042601	Bacteria	3589
11	Ga0466719_566996	3300042606	Bacteria	16389
12	Ga0466704_020679	3300042643	Bacteria	7397
13	Ga0466709_089450	3300042648	Bacteria	55766
14	Ga0466725_147725	3300042654	Bacteria	2210
15	GhopperDRAF_NODE_303541_len_4756_cov_7_287216	2035265001	Unclassified	4786
16	2227477118	2225789004	Bacteria	4600
17	Ga0068305_10001757	3300005083	Unclassified	35476
18	Ga0102737_1001192	3300007142	Bacteria	7517
19	Ga0466697_212831	3300042611	Bacteria	1170
20	Ga0123356_10008126	3300010049	Bacteria	10452
21	Ga0123356_10452468	3300010049	Bacteria	1432
22	Ga0123356_10760961	3300010049	Bacteria	1139
23	Ga0123353_10038242	3300010167	Unclassified	7540
24	Ga0123353_10120372	3300010167	Bacteria	4221
25	Ga0123353_10265853	3300010167	Bacteria	2646
26	Ga0316159_10577	3300030930	Unclassified	5508
27	Ga0466657_365540	3300042582	Bacteria	3582
28	Ga0466692_204818	3300042591	Bacteria	4547
29	Ga0466696_098568	3300042596	Bacteria	10026
30	Ga0466696_191503	3300042596	Bacteria	28288
31	Ga0466706_049267	3300042599	Bacteria	12653
32	Ga0466706_085096	3300042599	Bacteria	1705
33	Ga0466719_032484	3300042606	Bacteria	26409
34	Ga0466734_151724	3300042623	Bacteria	1463
35	Ga0466704_593648	3300042643	Bacteria	44691
36	Ga0466708_027553	3300042652	Bacteria	4380
37	Ga0466727_296962	3300042655	Bacteria	1577
38	IMNBL1DRAFT_c0000146	3300000062	Bacteria	63343
39	CVPL010L_1000033	3300002932	Unclassified	91433
40	Ga0466715_610857	3300042616	Bacteria	1632
41	Ga0123353_10076024	3300010167	Bacteria	5397
42	Ga0123353_10197363	3300010167	Bacteria	3171
43	Ga0123353_10213246	3300010167	Bacteria	3027
44	Ga0123353_10217169	3300010167	Bacteria	2994
45	Ga0123353_10495380	3300010167	Unclassified	1782
46	Ga0160446_100060	3300012835	Bacteria	113052
47	Ga0160444_100626	3300012841	Bacteria	12263
48	Ga0316159_10487	3300030930	Bacteria	9914
49	Ga0466692_101103	3300042591	Bacteria	19375
50	Ga0466701_048255	3300042598	Bacteria	2730
51	Ga0466713_080621	3300042602	Bacteria	3151
52	Ga0466719_123098	3300042606	Bacteria	142874
53	Ga0466709_299616	3300042648	Bacteria	2633
54	2227035913	2225789003	Unclassified	20753
55	2227106106	2225789004	Bacteria	1767
56	2227158575	2225789004	Unclassified	8405
57	2227549632	2225789004	Unclassified	15084
58	JGI24703J35330_11634644	3300002501	Bacteria	1512
59	Ga0103265_1009630	3300007068	Bacteria	1266
60	Ga0102739_1000230	3300007095	Bacteria	13826
61	Ga0466733_114175	3300042659	Bacteria	4566
62	Ga0466711_442512	3300042615	Bacteria	6261
63	Ga0466715_367373	3300042616	Bacteria	75621
64	Ga0466723_136013	3300042618	Bacteria	2757
65	Ga0466723_335811	3300042618	Bacteria	16701
66	Ga0466726_231822	3300042619	Bacteria	1613
67	Ga0466729_127392	3300042621	Bacteria	7865
68	Ga0123355_10002222	3300009826	Bacteria	27410
69	Ga0123355_10071763	3300009826	Bacteria	5557
70	Ga0123355_10257159	3300009826	Bacteria	2448
71	Ga0123356_10000177	3300010049	Bacteria	72517
72	Ga0123356_10006703	3300010049	Bacteria	11602
73	Ga0123356_10075474	3300010049	Bacteria	3175
74	Ga0123353_10010357	3300010167	Bacteria	12987
75	Ga0123353_10349597	3300010167	Bacteria	2228
76	Ga0160447_104692	3300012849	Bacteria	3984
77	Ga0466706_151369	3300042599	Unclassified	13494
78	Ga0466707_004690	3300042601	Bacteria	5205
79	Ga0466713_005920	3300042602	Bacteria	33790
80	Ga0466713_057069	3300042602	Bacteria	6150
81	Ga0466714_063398	3300042603	Bacteria	21454
82	Ga0466719_270167	3300042606	Bacteria	4291
83	Ga0466704_370638	3300042643	Unclassified	1616
84	Ga0466724_21146	3300042649	Bacteria	1418
85	JGI24702J35022_10045690	3300002462	Bacteria	2333
86	JGI24699J35502_11126186	3300002509	Unclassified	3918
87	Ga0466697_149980	3300042611	Bacteria	1318
88	Ga0466705_509054	3300042612	Bacteria	1783
89	Ga0466723_102398	3300042618	Bacteria	4162
90	Ga0123355_10000622	3300009826	Bacteria	47966
91	Ga0123355_10318774	3300009826	Unclassified	2097
92	Ga0123356_10182865	3300010049	Bacteria	2120
93	Ga0123354_10334371	3300010882	Bacteria	1376
94	Ga0160471_103610	3300012812	Bacteria	2298
95	Ga0160430_110154	3300012852	Bacteria	1642
96	Ga0247290_00754	3300035364	Unclassified	4974
97	Ga0466693_243721	3300042592	Bacteria	130981
98	Ga0466696_417523	3300042596	Bacteria	2471
99	Ga0466707_422929	3300042601	Bacteria	6182
100	Ga0466713_151488	3300042602	Bacteria	34283
101	Ga0466729_255045	3300042621	Bacteria	3644
102	Ga0466724_29324	3300042649	Unclassified	3618
103	AustNasuHG_c1013114	3300000089	Bacteria	2848
104	JGI24699J35502_11133172	3300002509	Bacteria	9064
105	Ga0052191_101350	3300003097	Bacteria	1145
106	Ga0466705_249163	3300042612	Unclassified	7171
107	Ga0466715_414478	3300042616	Bacteria	7125
108	Ga0466723_362351	3300042618	Bacteria	36768
109	Ga0123353_10051465	3300010167	Bacteria	6572
110	Ga0160453_101023	3300012814	Bacteria	12473
111	Ga0160433_101567	3300012846	Unclassified	6063
112	Ga0466719_269290	3300042606	Bacteria	2749
113	Ga0466703_410610	3300042636	Bacteria	14920
114	Ga0466725_095570	3300042654	Bacteria	3066
115	Ga0466725_447475	3300042654	Unclassified	7112
116	IMNBL1DRAFT_c0000019	3300000062	Bacteria	170255
117	JGI24705J35276_12216357	3300002504	Bacteria	2043
118	CVPL010W_10009460	3300002931	Bacteria	9754
119	Ga0562375_1323	3300056856	Bacteria	34538
120	Ga0123356_10004734	3300010049	Bacteria	14020
121	Ga0123356_10459551	3300010049	Bacteria	1423
122	Ga0123353_10098315	3300010167	Unclassified	4717
123	Ga0123353_10242360	3300010167	Bacteria	2800
124	Ga0123353_10434823	3300010167	Bacteria	1938
125	Ga0160442_100235	3300012806	Bacteria	40404
126	Ga0247289_0014	3300035363	Unclassified	66947
127	Ga0247290_00021	3300035364	Bacteria	63133
128	Ga0466694_215038	3300042594	Bacteria	5445
129	Ga0466706_237546	3300042599	Bacteria	99093
130	Ga0466714_168329	3300042603	Bacteria	5120
131	Ga0466731_019350	3300042622	Bacteria	5245
132	Ga0466730_005589	3300042625	Bacteria	36459
133	Ga0466727_198670	3300042655	Bacteria	2291
134	FGTW_contig30472	2065487013	Bacteria	25299
135	Ga0074278_142786	3300005721	Unclassified	4187
136	Ga0123355_10000894	3300009826	Bacteria	41319
137	Ga0123355_10234973	3300009826	Bacteria	2610
138	Ga0123355_10273608	3300009826	Bacteria	2342
139	Ga0123356_10001553	3300010049	Bacteria	25298
140	Ga0123356_10002234	3300010049	Bacteria	20856
141	Ga0123356_10120645	3300010049	Bacteria	2549
142	Ga0247290_00520	3300035364	Unclassified	6823
143	Ga0466691_107525	3300042593	Bacteria	3198
144	Ga0466700_164653	3300042600	Bacteria	2144
145	Ga0466709_337151	3300042648	Bacteria	14763
146	Ga0466725_373947	3300042654	Bacteria	3633
147	Ga0466725_392848	3300042654	Bacteria	1449
148	FGTW_contig30811	2065487013	Unclassified	9306
149	IMNBL1DRAFT_c0000256	3300000062	Bacteria	47115
150	JGI24702J35022_10000959	3300002462	Bacteria	18003
151	Ga0103264_1000211	3300007188	Bacteria	33223

📋 Family Sequences

#	Sample	Scaffold	Protein	Length (aa)
1	iso_pr_bacteria	2820901319	2820902094	314
2	3300002509	JGI24699J35502_11126186	JGI24699J35502_111261866	315
3	3300042591	Ga0466692_204818	Ga0466692_204818_314_1279	321
4	3300042602	Ga0466713_057069	Ga0466713_057069_28_993	321
5	3300042611	Ga0466697_212831	Ga0466697_212831_86_1057	323
6	iso_pr_bacteria	2511231129	2511734064	330
7	3300002509	JGI24699J35502_11133172	JGI24699J35502_1113317211	332
8	3300010167	Ga0123353_10010357	Ga0123353_100103578	333
9	3300010167	Ga0123353_10092479	Ga0123353_100924793	336
10	3300010167	Ga0123353_10349597	Ga0123353_103495973	339
11	3300010167	Ga0123353_10265853	Ga0123353_102658532	341
12	3300009826	Ga0123355_10318774	Ga0123355_103187742	343
13	3300010049	Ga0123356_10075474	Ga0123356_100754742	343
14	3300010049	Ga0123356_10001553	Ga0123356_1000155317	345
15	3300042616	Ga0466715_205939	Ga0466715_205939_4595_5632	345
16	3300010049	Ga0123356_10760961	Ga0123356_107609611	346
17	3300042594	Ga0466694_215038	Ga0466694_215038_4079_5122	347
18	3300012852	Ga0160430_110154	Ga0160430_1101542	348
19	iso_pr_bacteria	2718218026	2719802642	348
20	3300010049	Ga0123356_10002234	Ga0123356_100022341	349
21	iso_pr_bacteria	8078130113	8078133296	349
22	3300010882	Ga0123354_10334371	Ga0123354_103343711	350
23	iso_pr_bacteria	2711768164	2712504847	351
24	iso_pr_bacteria	2816332503	2818127027	351
25	iso_pr_bacteria	2816332545	2818333554	351
26	3300002501	JGI24703J35330_11634644	JGI24703J35330_116346441	352
27	iso_pr_bacteria	2820845766	2820847558	352
28	3300010167	Ga0123353_10038242	Ga0123353_100382421	353
29	3300042616	Ga0466715_610857	Ga0466715_610857_171_1238	355
30	3300007188	Ga0103264_1000211	Ga0103264_10002119	356
31	3300042616	Ga0466715_091559	Ga0466715_091559_2342_3412	356
32	iso_pr_bacteria	2609459925	2610645562	356
33	iso_pr_bacteria	2609459958	2610823915	356
34	iso_pr_bacteria	2627853677	2628496836	356
35	iso_pr_bacteria	2627854002	2629833610	356
36	iso_pr_bacteria	2630968716	2632956661	356
37	iso_pr_bacteria	2636415542	2636991916	356
38	iso_pr_bacteria	2648501820	2651394138	356
39	iso_pr_bacteria	2896925746	2896930155	356
40	iso_pr_bacteria	8116627632	8116633709	356
41	3300009826	Ga0123355_10257159	Ga0123355_102571592	358
42	3300007068	Ga0103265_1009630	Ga0103265_10096301	359
43	3300007095	Ga0102739_1000230	Ga0102739_10002302	359
44	3300056856	Ga0562375_1323	Ga0562375_1323_26450_27562	359
45	iso_pr_bacteria	2833053935	2833054421	359
46	iso_pr_bacteria	3000861951	3000862035	359
47	2065487013	FGTW_contig30472	FGTW_00819510	360
48	2065487013	FGTW_contig30811	FGTW_02262110	360
49	3300030930	Ga0316159_10577	Ga0316159_105771	360
50	3300035363	Ga0247289_0014	Ga0247289_0014_46808_47890	360
51	3300035364	Ga0247290_00520	Ga0247290_00520_14_1096	360
52	3300035364	Ga0247290_00754	Ga0247290_00754_3879_4961	360
53	3300042619	Ga0466726_231822	Ga0466726_231822_231_1313	360
54	3300042625	Ga0466730_005589	Ga0466730_005589_13597_14679	360
55	iso_pr_bacteria	2547132185	2547708119	360
56	iso_pr_bacteria	2551306516	2553379714	360
57	iso_pr_bacteria	2551306531	2553449708	360
58	iso_pr_bacteria	2822856742	2822858880	360
59	iso_pr_bacteria	2856068565	2856069731	360
60	iso_pr_bacteria	2874880541	2874881389	360
61	iso_pr_bacteria	2876334352	2876337234	360
62	iso_pr_bacteria	2876358570	2876360781	360
63	iso_pr_bacteria	2921816052	2921820326	360
64	iso_pr_bacteria	2921842437	2921845688	360
65	iso_pr_bacteria	2937427229	2937428224	360
66	iso_pr_bacteria	2957730672	2957733189	360
67	iso_pr_bacteria	2964846109	2964847580	360
68	iso_pr_bacteria	2964859436	2964862365	360
69	iso_pr_bacteria	2967915117	2967917140	360
70	iso_pr_bacteria	2967924226	2967928403	360
71	iso_pr_bacteria	2970322301	2970322736	360
72	iso_pr_bacteria	2970335472	2970336442	360
73	iso_pr_bacteria	2977691992	2977692789	360
74	iso_pr_bacteria	2977727922	2977730448	360
75	iso_pr_bacteria	2977745872	2977746249	360
76	iso_pr_bacteria	3004364956	3004367991	360
77	iso_pr_bacteria	8018312681	8018316463	360
78	3300002932	CVPL010L_1000033	CVPL010L_100003380	361
79	3300010167	Ga0123353_10434823	Ga0123353_104348232	361
80	3300042592	Ga0466693_243721	Ga0466693_243721_113793_114878	361
81	3300012814	Ga0160453_101023	Ga0160453_1010238	362
82	3300012841	Ga0160444_100626	Ga0160444_1006265	362
83	3300012846	Ga0160433_101567	Ga0160433_1015676	362
84	3300042623	Ga0466734_151724	Ga0466734_151724_97_1185	362
85	3300010167	Ga0123353_10213246	Ga0123353_102132463	363
86	3300042616	Ga0466715_414478	Ga0466715_414478_909_2000	363
87	iso_pr_bacteria	2820348946	2820350387	363
88	iso_pr_bacteria	2820803007	2820805819	363
89	iso_pr_bacteria	2820894511	2820896818	363
90	iso_pr_bacteria	2864816158	2864819017	363
91	3300002931	CVPL010W_10009460	CVPL010W_100094604	364
92	3300007142	Ga0102737_1001192	Ga0102737_10011924	364
93	3300012812	Ga0160471_103610	Ga0160471_1036102	364
94	3300042593	Ga0466691_107525	Ga0466691_107525_575_1669	364
95	3300042596	Ga0466696_098568	Ga0466696_098568_3292_4386	364
96	iso_pr_bacteria	2820867525	2820869147	364
97	3300010049	Ga0123356_10452468	Ga0123356_104524682	365
98	3300010167	Ga0123353_10098315	Ga0123353_100983153	365
99	3300042648	Ga0466709_299616	Ga0466709_299616_121_1218	365
100	3300042659	Ga0466733_114175	Ga0466733_114175_3279_4391	365
101	3300030930	Ga0316159_10487	Ga0316159_104877	366
102	iso_pr_bacteria	2884613238	2884615941	366
103	iso_pr_bacteria	8067987626	8067989586	366
104	3300042618	Ga0466723_102398	Ga0466723_102398_2838_3941	367
105	iso_pr_bacteria	2609459925	2610642421	367
106	iso_pr_bacteria	2609459958	2610827147	367
107	iso_pr_bacteria	2627853677	2628496178	367
108	iso_pr_bacteria	2627854002	2629833501	367
109	iso_pr_bacteria	2630968716	2632960605	367
110	iso_pr_bacteria	2636415542	2636992263	367
111	iso_pr_bacteria	2648501820	2651394213	367
112	iso_pr_bacteria	2820329821	2820329851	367
113	iso_pr_bacteria	2873595552	2873596024	367
114	iso_pr_bacteria	2896925746	2896929619	367
115	iso_pr_bacteria	8116627632	8116629293	367
116	2035265001	GhopperDRAF_NODE_303541_len_4756_cov_7_287216	GhopperDRAFT_288200	368
117	3300042598	Ga0466701_048255	Ga0466701_048255_1041_2147	368
118	3300042603	Ga0466714_168329	Ga0466714_168329_2041_3147	368
119	3300042618	Ga0466723_362351	Ga0466723_362351_34325_35431	368
120	3300042621	Ga0466729_255045	Ga0466729_255045_330_1436	368
121	3300042655	Ga0466727_296962	Ga0466727_296962_186_1292	368
122	3300003097	Ga0052191_101350	Ga0052191_1013501	369
123	3300010167	Ga0123353_10051465	Ga0123353_100514652	369
124	3300010167	Ga0123353_10120372	Ga0123353_101203722	369
125	3300010167	Ga0123353_10217169	Ga0123353_102171691	369
126	3300042596	Ga0466696_417523	Ga0466696_417523_282_1391	369
127	3300042606	Ga0466719_270167	Ga0466719_270167_2755_3864	369
128	iso_pr_bacteria	2820504582	2820505526	369
129	2225789003	2227035913	2227396270	370
130	2225789004	2227106106	2227491921	370
131	2225789004	2227158575	2227567192	370
132	2225789004	2227477118	2227930427	370
133	2225789004	2227549632	2228078136	370
134	3300002462	JGI24702J35022_10045690	JGI24702J35022_100456902	370
135	3300010049	Ga0123356_10008126	Ga0123356_100081264	370
136	3300010167	Ga0123353_10242621	Ga0123353_102426212	370
137	3300042599	Ga0466706_085096	Ga0466706_085096_297_1409	370
138	3300042599	Ga0466706_151369	Ga0466706_151369_7064_8176	370
139	3300042601	Ga0466707_422929	Ga0466707_422929_2469_3581	370
140	3300042602	Ga0466713_005920	Ga0466713_005920_32083_33195	370
141	3300042602	Ga0466713_080621	Ga0466713_080621_1350_2462	370
142	3300042602	Ga0466713_151488	Ga0466713_151488_25244_26356	370
143	3300042606	Ga0466719_269290	Ga0466719_269290_950_2062	370
144	3300042611	Ga0466697_149980	Ga0466697_149980_128_1240	370
145	3300042612	Ga0466705_249163	Ga0466705_249163_5244_6356	370
146	3300042616	Ga0466715_367373	Ga0466715_367373_9590_10702	370
147	3300042622	Ga0466731_019350	Ga0466731_019350_638_1750	370
148	3300042636	Ga0466703_410610	Ga0466703_410610_10840_11952	370
149	3300042643	Ga0466704_020679	Ga0466704_020679_127_1239	370
150	3300042643	Ga0466704_370638	Ga0466704_370638_339_1451	370
151	3300042648	Ga0466709_337151	Ga0466709_337151_8274_9386	370
152	3300042649	Ga0466724_29324	Ga0466724_29324_909_2021	370
153	3300042654	Ga0466725_373947	Ga0466725_373947_64_1176	370
154	3300042654	Ga0466725_392848	Ga0466725_392848_186_1298	370
155	3300042654	Ga0466725_447475	Ga0466725_447475_2269_3381	370
156	3300042655	Ga0466727_198670	Ga0466727_198670_45_1157	370
157	3300042659	Ga0466733_202421	Ga0466733_202421_12822_13934	370
158	iso_pr_bacteria	2504756063	2504978414	370
159	iso_pr_bacteria	2505679068	2505953762	370
160	iso_pr_bacteria	2820267566	2820269783	370
161	iso_pr_bacteria	2820492969	2820493791	370
162	iso_pr_bacteria	2912636047	2912638582	370
163	iso_pr_bacteria	2940264388	2940265432	370
164	iso_pr_bacteria	2940267548	2940268591	370
165	iso_pr_bacteria	2940270707	2940271751	370
166	iso_pr_bacteria	2940273867	2940274917	370
167	iso_pr_bacteria	8022116796	8022118584	370
168	iso_pr_bacteria	8022345672	8022345736	370
169	iso_pr_bacteria	8064531044	8064531331	370
170	3300000062	IMNBL1DRAFT_c0000019	IMNBL1DRAFT_000001945	371
171	3300000062	IMNBL1DRAFT_c0000146	IMNBL1DRAFT_000014627	371
172	3300000062	IMNBL1DRAFT_c0000256	IMNBL1DRAFT_00002568	371
173	3300000089	AustNasuHG_c1013114	AustNasuHG_10131141	371
174	3300005083	Ga0068305_10001757	Ga0068305_1000175724	371
175	3300009826	Ga0123355_10000894	Ga0123355_100008943	371
176	3300009826	Ga0123355_10002222	Ga0123355_1000222218	371
177	3300009826	Ga0123355_10002644	Ga0123355_100026447	371
178	3300009826	Ga0123355_10071763	Ga0123355_100717632	371
179	3300009826	Ga0123355_10273608	Ga0123355_102736081	371
180	3300010049	Ga0123356_10010394	Ga0123356_100103944	371
181	3300010049	Ga0123356_10120645	Ga0123356_101206452	371
182	3300010167	Ga0123353_10076024	Ga0123353_100760242	371
183	3300010167	Ga0123353_10197363	Ga0123353_101973632	371
184	3300010167	Ga0123353_10495380	Ga0123353_104953802	371
185	3300042582	Ga0466657_365540	Ga0466657_365540_2264_3379	371
186	3300042599	Ga0466706_237546	Ga0466706_237546_57150_58265	371
187	3300042654	Ga0466725_095570	Ga0466725_095570_524_1639	371
188	iso_pr_bacteria	2511231129	2511730315	371
189	iso_pr_bacteria	2565956518	2566024722	371
190	iso_pr_bacteria	2600255074	2600845627	371
191	iso_pr_bacteria	2648501158	2648748912	371
192	iso_pr_bacteria	2711768158	2712481448	371
193	iso_pr_bacteria	2791355471	2794375405	371
194	iso_pr_bacteria	2820516196	2820517926	371
195	iso_pr_bacteria	2820546020	2820547028	371
196	iso_pr_bacteria	2820922474	2820922826	371
197	iso_pr_bacteria	2989793055	2989794165	371
198	iso_pr_bacteria	3006225627	3006229325	371
199	iso_pr_bacteria	3006242587	3006245412	371
200	iso_pr_bacteria	8051461712	8051463237	371
201	iso_pr_bacteria	8051551332	8051552671	371
202	iso_pr_bacteria	8060845732	8060847476	371
203	3300002504	JGI24705J35276_12216357	JGI24705J35276_122163572	372
204	3300010049	Ga0123356_10000177	Ga0123356_1000017728	372
205	3300010049	Ga0123356_10006703	Ga0123356_100067038	372
206	3300010049	Ga0123356_10459551	Ga0123356_104595511	372
207	3300042600	Ga0466700_164653	Ga0466700_164653_963_2081	372
208	3300042643	Ga0466704_593648	Ga0466704_593648_15052_16170	372
209	3300042591	Ga0466692_101103	Ga0466692_101103_10755_11876	373
210	3300042654	Ga0466725_147725	Ga0466725_147725_156_1277	373
211	iso_pr_bacteria	2681812870	2682013278	373
212	iso_pr_bacteria	2820926697	2820928994	373
213	3300042606	Ga0466719_566996	Ga0466719_566996_3850_4974	374
214	3300042615	Ga0466711_088734	Ga0466711_088734_14_1138	374
215	3300042618	Ga0466723_335811	Ga0466723_335811_11202_12326	374
216	iso_pr_bacteria	2884351759	2884352985	374
217	3300012806	Ga0160442_100235	Ga0160442_10023523	375
218	3300012835	Ga0160446_100060	Ga0160446_10006035	375
219	3300042621	Ga0466729_127392	Ga0466729_127392_3305_4432	375
220	3300042652	Ga0466708_027553	Ga0466708_027553_1739_2866	375
221	iso_pr_bacteria	2513237174	2514075347	375
222	iso_pr_bacteria	2519899775	2520953671	375
223	iso_pr_bacteria	2568526170	2569119689	375
224	iso_pr_bacteria	2597490194	2598674988	375
225	iso_pr_bacteria	2597490239	2598798519	375
226	iso_pr_bacteria	2600255079	2600868522	375
227	iso_pr_bacteria	2645727657	2646405962	375
228	iso_pr_bacteria	2660238275	2661719335	375
229	iso_pr_bacteria	2663763384	2666812321	375
230	iso_pr_bacteria	2671180601	2673428447	375
231	iso_pr_bacteria	2684622916	2686083545	375
232	iso_pr_bacteria	2684622917	2686084956	375
233	iso_pr_bacteria	2684622918	2686086772	375
234	iso_pr_bacteria	2684622919	2686088514	375
235	iso_pr_bacteria	2684622920	2686090124	375
236	iso_pr_bacteria	2693429521	2693516957	375
237	iso_pr_bacteria	2788500098	2789514656	375
238	iso_pr_bacteria	2802429577	2805813138	375
239	iso_pr_bacteria	2808606957	2811757024	375
240	iso_pr_bacteria	2865983822	2865984867	375
241	iso_pr_bacteria	2879643867	2879644875	375
242	iso_pr_bacteria	8024981139	8024982910	375
243	iso_pr_bacteria	8024982947	8024984557	375
244	iso_pr_bacteria	8024984606	8024986341	375
245	iso_pr_bacteria	8024986378	8024988180	375
246	iso_pr_bacteria	8032009961	8032011354	375
247	iso_pr_bacteria	8110340172	8110340866	375
248	iso_pr_bacteria	8110341875	8110342987	375
249	3300005721	Ga0074278_142786	Ga0074278_1427862	376
250	3300012858	Ga0160457_1000020	Ga0160457_100002099	376
251	3300042603	Ga0466714_063398	Ga0466714_063398_9547_10677	376
252	iso_pr_bacteria	2883361506	2883364479	376
253	3300009826	Ga0123355_10234973	Ga0123355_102349732	377
254	3300035364	Ga0247290_00021	Ga0247290_00021_13496_14629	377
255	3300042612	Ga0466705_509054	Ga0466705_509054_437_1570	377
256	3300010167	Ga0123353_10242360	Ga0123353_102423603	378
257	3300042618	Ga0466723_136013	Ga0466723_136013_46_1182	378
258	iso_pr_bacteria	2862075925	2862078082	378
259	iso_pr_bacteria	2865982043	2865982493	378
260	iso_pr_bacteria	2820600392	2820600993	379
261	3300009826	Ga0123355_10000622	Ga0123355_100006229	380
262	3300010049	Ga0123356_10182865	Ga0123356_101828652	383
263	3300042615	Ga0466711_442512	Ga0466711_442512_88_1239	383
264	3300042649	Ga0466724_21146	Ga0466724_21146_43_1194	383
265	3300002462	JGI24702J35022_10000959	JGI24702J35022_100009597	385
266	3300012849	Ga0160447_104692	Ga0160447_1046922	387
267	3300042606	Ga0466719_123098	Ga0466719_123098_34535_35704	389
268	3300042601	Ga0466707_004690	Ga0466707_004690_1540_2712	390
269	3300042599	Ga0466706_049267	Ga0466706_049267_631_1839	402
270	3300042601	Ga0466707_405810	Ga0466707_405810_1426_2634	402
271	3300042648	Ga0466709_089450	Ga0466709_089450_380_1606	408
272	3300010049	Ga0123356_10004734	Ga0123356_100047349	410
273	3300042606	Ga0466719_032484	Ga0466719_032484_11970_13211	413
274	iso_pr_bacteria	2820211246	2820214030	424
275	3300042596	Ga0466696_191503	Ga0466696_191503_8111_9409	432

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM ID	Name	Description	Start	End	Accuracy
PF17912	OB_MalK	MalK OB fold domain	249	303	0.97
PF00005	ABC_tran	ABC transporter	35	175	0.97
PF08402	TOBE_2	TOBE domain	297	371	0.89
PF02463	SMC_N	RecF/RecN/SMC N terminal domain	43	221	0.77

⚛️ Structure & Feature Viewer

pLDDT	pTM	Quality
0.92	0.92	High

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.