Protein Family IF06445

Metagenome Isolate
171 Members
52 Samples
160 Scaffolds
164.86 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_021770|Ga0466719_021770_3408_3989
Length
193 aa
Sequence
MRANIREKFRFYKFCMDKNPIFALMIRIGLLSDTHGWWDDKYVKYFGTCDEIWHAGDIGSETLARDLADIKPLRAVYGNIDGYPLRRQFPMTAQFKVEDIKVMMTHIGGYPGRYDPSVRAELYAAKPQLFISGHSHILKVMFDKNLRCLHINPGAAGISGFQQVRTLVRFVIDGSEIKELEIIELGNRNERGI

📊 Sample Types

Isolate 6.4%
Metagenome 93.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.5%
Kalotermitidae 27.5%
Blattidae 15.7%
Unclassified 9.8%
Termopsidae 7.8%
Rhinotermitidae 5.9%
Hodotermitidae 2.0%
Armadillidiidae 2.0%
Passalidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 165
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
11 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
12 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
22 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
23 3004667792 Bacteroides sp. 519 Isolate Blattidae
24 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
31 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
32 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
35 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
36 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
39 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
41 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
42 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
43 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
44 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
45 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
46 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
49 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
50 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
51 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
52 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_230580 3300042611 Bacteria 1524
2 Ga0466732_109749 3300042656 Bacteria 1884
3 Ga0466733_117754 3300042659 Bacteria 7100
4 Ga0466690_272093 3300042590 Bacteria 3525
5 Ga0466696_016314 3300042596 Bacteria 8866
6 Ga0466696_080846 3300042596 Bacteria 1417
7 Ga0466715_107026 3300042616 Bacteria 6269
8 Ga0466715_373317 3300042616 Bacteria 12645
9 Ga0466715_439531 3300042616 Bacteria 13538
10 Ga0466728_371699 3300042620 Bacteria 5586
11 Ga0466701_081567 3300042598 Bacteria 1997
12 Ga0466706_073156 3300042599 Bacteria 4541
13 Ga0466703_153246 3300042636 Bacteria 7240
14 Ga0466727_170500 3300042655 Bacteria 6367
15 IMNBL1DRAFT_c0002548 3300000062 Bacteria 12583
16 JGI24702J35022_10152367 3300002462 Bacteria 1298
17 JGI24696J40584_12958040 3300002834 Bacteria 3845
18 Ga0466705_071610 3300042612 Bacteria 13460
19 Ga0466705_128991 3300042612 Bacteria 11303
20 Ga0466705_246410 3300042612 Bacteria 1992
21 Ga0466690_064197 3300042590 Bacteria 1428
22 Ga0466711_222576 3300042615 Bacteria 8667
23 Ga0466711_384875 3300042615 Bacteria 47167
24 Ga0466715_134828 3300042616 Bacteria 35442
25 Ga0466715_286948 3300042616 Bacteria 13632
26 Ga0123356_10686531 3300010049 Bacteria 1192
27 Ga0123356_12802358 3300010049 Bacteria 610
28 Ga0466707_119472 3300042601 Bacteria 9937
29 Ga0466713_087495 3300042602 Bacteria 10882
30 Ga0466729_316363 3300042621 Bacteria 5483
31 Ga0466735_226098 3300042624 Bacteria 3202
32 Ga0466703_045963 3300042636 Unclassified 2737
33 Ga0466709_378565 3300042648 Bacteria 2052
34 Ga0466708_254700 3300042652 Bacteria 40254
35 Ga0466725_372140 3300042654 Bacteria 27057
36 Ga0466727_065441 3300042655 Bacteria 2493
37 Ga0466727_346342 3300042655 Bacteria 4900
38 IMNBL1DRAFT_c0008471 3300000062 Bacteria 5229
39 JGI24705J35276_12160903 3300002504 Bacteria 1232
40 JGI24696J40584_12953847 3300002834 Bacteria 2544
41 Ga0466733_012698 3300042659 Bacteria 1949
42 Ga0265387_1075153 3300024582 Bacteria 659
43 Ga0466690_273522 3300042590 Bacteria 2812
44 Ga0466691_094124 3300042593 Bacteria 8010
45 Ga0466696_008900 3300042596 Bacteria 14230
46 Ga0466696_206637 3300042596 Bacteria 2737
47 Ga0466710_231396 3300042613 Bacteria 15584
48 Ga0466726_177316 3300042619 Bacteria 2962
49 Ga0466726_225768 3300042619 Bacteria 1060
50 Ga0466726_253165 3300042619 Bacteria 3070
51 Ga0466726_419298 3300042619 Bacteria 1550
52 Ga0466728_396980 3300042620 Bacteria 8198
53 Ga0466706_133883 3300042599 Bacteria 39086
54 Ga0466713_085543 3300042602 Bacteria 51640
55 Ga0466713_141379 3300042602 Bacteria 226907
56 Ga0466719_021770 3300042606 Bacteria 8117
57 Ga0466703_193733 3300042636 Bacteria 3232
58 Ga0466704_243231 3300042643 Bacteria 4173
59 Ga0466708_043101 3300042652 Bacteria 7169
60 Ga0466727_019997 3300042655 Bacteria 1221
61 IMNBL1DRAFT_c0052267 3300000062 Bacteria 1281
62 Ga0466705_061372 3300042612 Bacteria 3173
63 Ga0466657_340658 3300042582 Unclassified 1804
64 Ga0466690_025734 3300042590 Bacteria 11601
65 Ga0466690_168180 3300042590 Bacteria 14796
66 Ga0466710_292378 3300042613 Bacteria 1838
67 Ga0466711_328602 3300042615 Bacteria 5891
68 Ga0466715_139422 3300042616 Bacteria 3530
69 Ga0466715_358000 3300042616 Bacteria 3709
70 Ga0466728_002157 3300042620 Bacteria 6333
71 Ga0466728_158816 3300042620 Bacteria 9395
72 Ga0123353_10118971 3300010167 Bacteria 4248
73 Ga0123353_10136583 3300010167 Bacteria 3932
74 Ga0123353_10287963 3300010167 Bacteria 2517
75 Ga0466713_035920 3300042602 Bacteria 98273
76 Ga0466716_230694 3300042605 Bacteria 14957
77 Ga0466719_242337 3300042606 Bacteria 14756
78 Ga0466719_274637 3300042606 Bacteria 3496
79 Ga0466703_247716 3300042636 Bacteria 7183
80 Ga0466704_340948 3300042643 Bacteria 2712
81 Ga0466708_210049 3300042652 Bacteria 11481
82 Ga0466727_191150 3300042655 Bacteria 17261
83 Ga0466690_061665 3300042590 Bacteria 6718
84 Ga0466690_122659 3300042590 Bacteria 11163
85 Ga0466696_107761 3300042596 Bacteria 30257
86 Ga0466711_117154 3300042615 Bacteria 17125
87 Ga0466711_139037 3300042615 Bacteria 18954
88 Ga0466711_204836 3300042615 Bacteria 21772
89 Ga0466723_167469 3300042618 Bacteria 6711
90 Ga0466728_287418 3300042620 Bacteria 1006
91 Ga0466707_063394 3300042601 Bacteria 26550
92 Ga0466707_379457 3300042601 Bacteria 6166
93 Ga0466713_087582 3300042602 Bacteria 12839
94 Ga0466716_306257 3300042605 Bacteria 14675
95 Ga0466735_159280 3300042624 Bacteria 2415
96 Ga0466704_022411 3300042643 Bacteria 3764
97 Ga0466704_033935 3300042643 Bacteria 4205
98 Ga0466727_261367 3300042655 Bacteria 12029
99 IMNBL1DRAFT_c0005216 3300000062 Bacteria 7506
100 JGI24702J35022_10681482 3300002462 Bacteria 638
101 Ga0068305_10104140 3300005083 Bacteria 7124
102 Ga0466697_106599 3300042611 Bacteria 91903
103 Ga0466656_102351 3300042550 Bacteria 1098
104 Ga0466690_053388 3300042590 Bacteria 18157
105 Ga0466690_214107 3300042590 Bacteria 2978
106 Ga0466696_264049 3300042596 Bacteria 1895
107 Ga0466705_397640 3300042612 Bacteria 4830
108 Ga0466711_359360 3300042615 Bacteria 14266
109 Ga0466715_065792 3300042616 Bacteria 3459
110 Ga0466715_073194 3300042616 Bacteria 7471
111 Ga0466723_045427 3300042618 Bacteria 5231
112 Ga0466723_048213 3300042618 Bacteria 35911
113 Ga0466728_038037 3300042620 Bacteria 2665
114 Ga0466728_119798 3300042620 Bacteria 9621
115 Ga0466728_179341 3300042620 Bacteria 35746
116 Ga0466707_078976 3300042601 Bacteria 10553
117 Ga0466713_117586 3300042602 Bacteria 26755
118 Ga0466703_006089 3300042636 Bacteria 13833
119 Ga0466703_205652 3300042636 Bacteria 2589
120 Ga0466708_067867 3300042652 Bacteria 4300
121 Ga0466708_117680 3300042652 Unclassified 2132
122 Ga0466727_026757 3300042655 Bacteria 1764
123 IMNBL1DRAFT_c0017133 3300000062 Bacteria 3067
124 Ga0466705_097582 3300042612 Unclassified 1686
125 Ga0466733_014741 3300042659 Bacteria 52817
126 Ga0466656_315259 3300042550 Bacteria 1499
127 Ga0466690_268790 3300042590 Bacteria 12537
128 Ga0466691_154870 3300042593 Bacteria 1076
129 Ga0466705_472302 3300042612 Unclassified 7691
130 Ga0466715_031414 3300042616 Bacteria 7074
131 Ga0466728_427300 3300042620 Bacteria 6266
132 Ga0466728_446198 3300042620 Unclassified 3048
133 Ga0123353_10507762 3300010167 Bacteria 1754
134 Ga0466714_084062 3300042603 Bacteria 1093
135 Ga0466725_201989 3300042654 Bacteria 20545
136 Ga0466727_233746 3300042655 Bacteria 10448
137 IMNBL1DRAFT_c0102199 3300000062 Bacteria 769
138 Ga0466733_038286 3300042659 Bacteria 266317
139 Ga0466733_088000 3300042659 Bacteria 4445
140 Ga0160433_100342 3300012846 Bacteria 27928
141 Ga0466657_068251 3300042582 Bacteria 20125
142 Ga0466690_119560 3300042590 Bacteria 3252
143 Ga0466692_022928 3300042591 Bacteria 2149
144 Ga0466691_039068 3300042593 Bacteria 9188
145 Ga0466691_072424 3300042593 Bacteria 10125
146 Ga0466696_094787 3300042596 Bacteria 1237
147 Ga0466696_186341 3300042596 Bacteria 8260
148 Ga0466696_293409 3300042596 Bacteria 4885
149 Ga0466711_325789 3300042615 Bacteria 11504
150 Ga0466723_284877 3300042618 Bacteria 14758
151 Ga0466729_107490 3300042621 Bacteria 2460
152 Ga0123353_12184902 3300010167 Bacteria 670
153 Ga0466713_083078 3300042602 Bacteria 18366
154 Ga0466716_191285 3300042605 Bacteria 1771
155 Ga0466716_535289 3300042605 Bacteria 1913
156 Ga0466719_517989 3300042606 Bacteria 5894
157 Ga0466703_418540 3300042636 Bacteria 1352
158 Ga0466709_123126 3300042648 Bacteria 5251
159 JGI24702J35022_10068626 3300002462 Bacteria 1906
160 Ga0068302_10027782 3300005071 Bacteria 7223

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_446198 Ga0466728_446198_19_435 138
2 3300042590 Ga0466690_025734 Ga0466690_025734_761_1246 161
3 3300042590 Ga0466690_119560 Ga0466690_119560_2750_3235 161
4 3300042593 Ga0466691_039068 Ga0466691_039068_5050_5535 161
5 3300042596 Ga0466696_008900 Ga0466696_008900_1382_1867 161
6 3300042596 Ga0466696_094787 Ga0466696_094787_224_709 161
7 3300042605 Ga0466716_191285 Ga0466716_191285_795_1280 161
8 3300042605 Ga0466716_535289 Ga0466716_535289_471_956 161
9 3300042606 Ga0466719_517989 Ga0466719_517989_3845_4330 161
10 3300042612 Ga0466705_397640 Ga0466705_397640_3657_4142 161
11 3300042615 Ga0466711_222576 Ga0466711_222576_540_1025 161
12 3300042615 Ga0466711_328602 Ga0466711_328602_2029_2514 161
13 3300042616 Ga0466715_286948 Ga0466715_286948_8295_8780 161
14 3300042618 Ga0466723_045427 Ga0466723_045427_1815_2300 161
15 3300042618 Ga0466723_048213 Ga0466723_048213_28467_28952 161
16 3300042619 Ga0466726_225768 Ga0466726_225768_375_860 161
17 3300042619 Ga0466726_419298 Ga0466726_419298_661_1146 161
18 3300042620 Ga0466728_002157 Ga0466728_002157_4170_4655 161
19 3300042620 Ga0466728_038037 Ga0466728_038037_664_1149 161
20 3300042620 Ga0466728_179341 Ga0466728_179341_30904_31389 161
21 3300042620 Ga0466728_371699 Ga0466728_371699_53_538 161
22 3300042620 Ga0466728_427300 Ga0466728_427300_2603_3088 161
23 3300042636 Ga0466703_418540 Ga0466703_418540_248_733 161
24 3300042643 Ga0466704_243231 Ga0466704_243231_242_727 161
25 3300042652 Ga0466708_043101 Ga0466708_043101_2718_3203 161
26 3300042652 Ga0466708_067867 Ga0466708_067867_2535_3020 161
27 3300042652 Ga0466708_117680 Ga0466708_117680_1324_1809 161
28 3300042655 Ga0466727_019997 Ga0466727_019997_725_1210 161
29 3300042655 Ga0466727_233746 Ga0466727_233746_5117_5602 161
30 3300000062 IMNBL1DRAFT_c0017133 IMNBL1DRAFT_00171332 162
31 3300005071 Ga0068302_10027782 Ga0068302_100277826 162
32 3300042590 Ga0466690_268790 Ga0466690_268790_3295_3783 162
33 3300042593 Ga0466691_072424 Ga0466691_072424_2683_3171 162
34 3300042615 Ga0466711_204836 Ga0466711_204836_18644_19132 162
35 3300042615 Ga0466711_384875 Ga0466711_384875_29347_29835 162
36 3300042619 Ga0466726_177316 Ga0466726_177316_839_1327 162
37 3300042624 Ga0466735_159280 Ga0466735_159280_1791_2279 162
38 3300042654 Ga0466725_372140 Ga0466725_372140_1731_2219 162
39 3300042655 Ga0466727_026757 Ga0466727_026757_453_941 162
40 3300042655 Ga0466727_346342 Ga0466727_346342_515_1003 162
41 iso_pr_bacteria 2940209341 2940211416 162
42 3300000062 IMNBL1DRAFT_c0008471 IMNBL1DRAFT_000847111 163
43 3300002834 JGI24696J40584_12958040 JGI24696J40584_129580404 163
44 3300042590 Ga0466690_064197 Ga0466690_064197_405_896 163
45 3300042590 Ga0466690_168180 Ga0466690_168180_7122_7613 163
46 3300042590 Ga0466690_214107 Ga0466690_214107_383_874 163
47 3300042593 Ga0466691_094124 Ga0466691_094124_7047_7538 163
48 3300042598 Ga0466701_081567 Ga0466701_081567_855_1346 163
49 3300042601 Ga0466707_063394 Ga0466707_063394_12925_13416 163
50 3300042602 Ga0466713_035920 Ga0466713_035920_41227_41718 163
51 3300042611 Ga0466697_106599 Ga0466697_106599_57855_58346 163
52 3300042612 Ga0466705_097582 Ga0466705_097582_1042_1533 163
53 3300042612 Ga0466705_246410 Ga0466705_246410_887_1378 163
54 3300042612 Ga0466705_472302 Ga0466705_472302_6928_7419 163
55 3300042615 Ga0466711_117154 Ga0466711_117154_7964_8455 163
56 3300042615 Ga0466711_139037 Ga0466711_139037_17992_18483 163
57 3300042615 Ga0466711_325789 Ga0466711_325789_5214_5705 163
58 3300042616 Ga0466715_073194 Ga0466715_073194_245_736 163
59 3300042616 Ga0466715_107026 Ga0466715_107026_5690_6181 163
60 3300042616 Ga0466715_139422 Ga0466715_139422_2904_3395 163
61 3300042618 Ga0466723_284877 Ga0466723_284877_13919_14410 163
62 3300042620 Ga0466728_158816 Ga0466728_158816_1678_2169 163
63 3300042620 Ga0466728_287418 Ga0466728_287418_360_851 163
64 3300042636 Ga0466703_045963 Ga0466703_045963_317_808 163
65 3300042652 Ga0466708_254700 Ga0466708_254700_37777_38268 163
66 3300042655 Ga0466727_261367 Ga0466727_261367_6782_7273 163
67 3300042656 Ga0466732_109749 Ga0466732_109749_569_1060 163
68 3300042659 Ga0466733_012698 Ga0466733_012698_1337_1828 163
69 iso_pr_bacteria 2695420314 2695471781 163
70 iso_pr_bacteria 2830041218 2830041258 163
71 iso_pr_bacteria 2940244548 2940245820 163
72 iso_pr_bacteria 2940248789 2940250028 163
73 iso_pr_bacteria 2940253009 2940254246 163
74 iso_pr_bacteria 2940257232 2940258270 163
75 iso_pr_bacteria 3004667792 3004669013 163
76 iso_pr_bacteria 8100166142 8100166739 163
77 3300002834 JGI24696J40584_12953847 JGI24696J40584_129538472 164
78 3300042550 Ga0466656_102351 Ga0466656_102351_491_985 164
79 3300042590 Ga0466690_122659 Ga0466690_122659_4437_4931 164
80 3300042591 Ga0466692_022928 Ga0466692_022928_672_1166 164
81 3300042593 Ga0466691_154870 Ga0466691_154870_407_901 164
82 3300042596 Ga0466696_080846 Ga0466696_080846_542_1036 164
83 3300042596 Ga0466696_107761 Ga0466696_107761_24227_24721 164
84 3300042596 Ga0466696_293409 Ga0466696_293409_704_1198 164
85 3300042599 Ga0466706_073156 Ga0466706_073156_3066_3560 164
86 3300042599 Ga0466706_133883 Ga0466706_133883_2275_2769 164
87 3300042602 Ga0466713_087495 Ga0466713_087495_9998_10492 164
88 3300042602 Ga0466713_087582 Ga0466713_087582_5004_5498 164
89 3300042602 Ga0466713_117586 Ga0466713_117586_24748_25242 164
90 3300042602 Ga0466713_141379 Ga0466713_141379_37201_37695 164
91 3300042605 Ga0466716_306257 Ga0466716_306257_7162_7656 164
92 3300042611 Ga0466697_230580 Ga0466697_230580_628_1122 164
93 3300042612 Ga0466705_061372 Ga0466705_061372_2510_3004 164
94 3300042612 Ga0466705_071610 Ga0466705_071610_10054_10548 164
95 3300042613 Ga0466710_292378 Ga0466710_292378_410_904 164
96 3300042616 Ga0466715_134828 Ga0466715_134828_8887_9381 164
97 3300042616 Ga0466715_358000 Ga0466715_358000_3078_3572 164
98 3300042616 Ga0466715_373317 Ga0466715_373317_9276_9770 164
99 3300042618 Ga0466723_167469 Ga0466723_167469_4437_4931 164
100 3300042619 Ga0466726_253165 Ga0466726_253165_254_748 164
101 3300042620 Ga0466728_119798 Ga0466728_119798_494_988 164
102 3300042648 Ga0466709_123126 Ga0466709_123126_1711_2205 164
103 3300042652 Ga0466708_210049 Ga0466708_210049_4547_5041 164
104 3300042655 Ga0466727_170500 Ga0466727_170500_3073_3567 164
105 3300042659 Ga0466733_117754 Ga0466733_117754_4287_4781 164
106 iso_pr_bacteria 2940195863 2940196368 164
107 iso_pr_bacteria 2940202316 2940203280 164
108 3300000062 IMNBL1DRAFT_c0002548 IMNBL1DRAFT_00025488 165
109 3300005083 Ga0068305_10104140 Ga0068305_101041403 165
110 3300010049 Ga0123356_10686531 Ga0123356_106865312 165
111 3300010049 Ga0123356_12802358 Ga0123356_128023582 165
112 3300010167 Ga0123353_10118971 Ga0123353_101189714 165
113 3300010167 Ga0123353_10136583 Ga0123353_101365834 165
114 3300010167 Ga0123353_10287963 Ga0123353_102879632 165
115 3300010167 Ga0123353_10507762 Ga0123353_105077622 165
116 3300010167 Ga0123353_12184902 Ga0123353_121849022 165
117 3300012846 Ga0160433_100342 Ga0160433_1003429 165
118 3300042582 Ga0466657_068251 Ga0466657_068251_11558_12055 165
119 3300042596 Ga0466696_016314 Ga0466696_016314_7792_8289 165
120 3300042596 Ga0466696_206637 Ga0466696_206637_38_535 165
121 3300042596 Ga0466696_264049 Ga0466696_264049_182_679 165
122 3300042601 Ga0466707_078976 Ga0466707_078976_1320_1817 165
123 3300042601 Ga0466707_119472 Ga0466707_119472_3842_4339 165
124 3300042602 Ga0466713_085543 Ga0466713_085543_1022_1519 165
125 3300042603 Ga0466714_084062 Ga0466714_084062_205_702 165
126 3300042606 Ga0466719_274637 Ga0466719_274637_1947_2444 165
127 3300042620 Ga0466728_396980 Ga0466728_396980_5871_6368 165
128 3300042621 Ga0466729_316363 Ga0466729_316363_2902_3399 165
129 3300042636 Ga0466703_153246 Ga0466703_153246_664_1161 165
130 3300042643 Ga0466704_340948 Ga0466704_340948_2148_2645 165
131 3300042655 Ga0466727_065441 Ga0466727_065441_343_840 165
132 3300002462 JGI24702J35022_10068626 JGI24702J35022_100686265 166
133 3300002462 JGI24702J35022_10681482 JGI24702J35022_106814821 166
134 3300024582 Ga0265387_1075153 Ga0265387_10751531 166
135 3300042596 Ga0466696_186341 Ga0466696_186341_2370_2870 166
136 3300042601 Ga0466707_379457 Ga0466707_379457_3022_3522 166
137 3300042602 Ga0466713_083078 Ga0466713_083078_9515_10015 166
138 3300042616 Ga0466715_065792 Ga0466715_065792_999_1499 166
139 3300042616 Ga0466715_439531 Ga0466715_439531_10014_10514 166
140 3300042636 Ga0466703_193733 Ga0466703_193733_1786_2286 166
141 3300042648 Ga0466709_378565 Ga0466709_378565_852_1352 166
142 3300042659 Ga0466733_014741 Ga0466733_014741_34445_34945 166
143 3300000062 IMNBL1DRAFT_c0052267 IMNBL1DRAFT_00522672 167
144 3300000062 IMNBL1DRAFT_c0102199 IMNBL1DRAFT_01021992 167
145 3300042590 Ga0466690_272093 Ga0466690_272093_2984_3487 167
146 3300042590 Ga0466690_273522 Ga0466690_273522_2271_2774 167
147 3300042616 Ga0466715_031414 Ga0466715_031414_2722_3225 167
148 3300042621 Ga0466729_107490 Ga0466729_107490_1506_2012 168
149 3300042636 Ga0466703_247716 Ga0466703_247716_2260_2766 168
150 3300002504 JGI24705J35276_12160903 JGI24705J35276_121609031 169
151 3300042590 Ga0466690_053388 Ga0466690_053388_11097_11606 169
152 3300042590 Ga0466690_061665 Ga0466690_061665_6107_6616 169
153 3300042606 Ga0466719_242337 Ga0466719_242337_9414_9923 169
154 3300042643 Ga0466704_033935 Ga0466704_033935_324_833 169
155 3300042605 Ga0466716_230694 Ga0466716_230694_2374_2886 170
156 3300042636 Ga0466703_006089 Ga0466703_006089_2992_3504 170
157 3300042636 Ga0466703_205652 Ga0466703_205652_122_634 170
158 3300042654 Ga0466725_201989 Ga0466725_201989_12618_13130 170
159 3300042655 Ga0466727_191150 Ga0466727_191150_8774_9286 170
160 3300042659 Ga0466733_038286 Ga0466733_038286_100233_100745 170
161 3300042659 Ga0466733_088000 Ga0466733_088000_3237_3749 170
162 3300000062 IMNBL1DRAFT_c0005216 IMNBL1DRAFT_00052163 172
163 3300042615 Ga0466711_359360 Ga0466711_359360_12121_12642 173
164 3300042643 Ga0466704_022411 Ga0466704_022411_640_1161 173
165 3300042582 Ga0466657_340658 Ga0466657_340658_853_1398 181
166 3300042613 Ga0466710_231396 Ga0466710_231396_11739_12284 181
167 3300042624 Ga0466735_226098 Ga0466735_226098_219_773 184
168 3300042612 Ga0466705_128991 Ga0466705_128991_4432_4989 185
169 3300002462 JGI24702J35022_10152367 JGI24702J35022_101523672 186
170 3300042550 Ga0466656_315259 Ga0466656_315259_666_1244 192
171 3300042606 Ga0466719_021770 Ga0466719_021770_3408_3989 193

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12850 Metallophos_2 Calcineurin-like phosphoesterase superfamily domain 27 172 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.