Protein Family IF06442

Metagenome Isolate
179 Members
41 Samples
176 Scaffolds
306.5 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_015413|Ga0466719_015413_825_1751
Length
303 aa
Sequence
MARVEKITDLIGKTPIVKINKLNDGGATVYVKLEYFNPLHSVKDRIALAMIEAAEKDGRITKDTTIIEPTSGNTGIGLAFIAAVKGYKLILTMPETMSIERRKLLKALGAQLVLTEGAKGMKGAIAKAEELAASTPNSFIPQQFDNPANPKIHEKTTGDTEGKVDILIGGVGTGGTISGAGKFLKSKKPSVQVIAVEPASSPVLSGGSPGPHKIQGIGAGFIPKVFDKAVVDEIYETDDTKAAYAARRAAKEEGLFVGISSGSALEAALTVAKRPENKGKTIVAILPDTGERYLSTWLWDDAS

📊 Sample Types

Isolate 1.7%
Metagenome 98.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.0%
Termitidae 32.5%
Unclassified 12.5%
Rhinotermitidae 10.0%
Termopsidae 7.5%
Hodotermitidae 2.5%

🌳 Taxonomy

Archaea 0
Bacteria 164
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
18 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 650716102 Treponema primitia ZAS-2 Isolate Unclassified
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
37 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
40 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_010917 3300042624 Bacteria 1916
2 Ga0466703_037051 3300042636 Bacteria 10749
3 Ga0466703_158527 3300042636 Bacteria 7401
4 Ga0466709_291056 3300042648 Bacteria 11484
5 Ga0466708_298050 3300042652 Unclassified 1532
6 Ga0466727_089824 3300042655 Bacteria 1696
7 Ga0466706_151899 3300042599 Bacteria 4999
8 Ga0466707_163217 3300042601 Bacteria 8991
9 Ga0466707_263373 3300042601 Bacteria 1283
10 Ga0466716_196998 3300042605 Bacteria 4478
11 Ga0466722_107857 3300042609 Bacteria 1869
12 Ga0466692_001517 3300042591 Bacteria 1440
13 Ga0466715_329333 3300042616 Bacteria 4605
14 Ga0466715_404673 3300042616 Unclassified 2951
15 Ga0466726_084190 3300042619 Bacteria 1480
16 Ga0466726_373418 3300042619 Bacteria 4981
17 Ga0466726_476171 3300042619 Bacteria 1559
18 Ga0466728_024517 3300042620 Bacteria 21124
19 Ga0466728_140308 3300042620 Bacteria 3130
20 Ga0466729_116417 3300042621 Bacteria 1073
21 Ga0466729_125155 3300042621 Bacteria 1490
22 JGI24695J34938_10073105 3300002450 Bacteria 1429
23 Ga0466703_098539 3300042636 Bacteria 5658
24 Ga0466703_177672 3300042636 Bacteria 1349
25 Ga0466704_163745 3300042643 Bacteria 4013
26 Ga0466709_387105 3300042648 Bacteria 2288
27 Ga0466708_274857 3300042652 Bacteria 29137
28 Ga0466707_073344 3300042601 Bacteria 10549
29 Ga0466707_080480 3300042601 Unclassified 1295
30 Ga0466719_424391 3300042606 Bacteria 2953
31 Ga0466719_430518 3300042606 Unclassified 1179
32 Ga0466719_498100 3300042606 Bacteria 1765
33 Ga0466698_434685 3300042610 Bacteria 3582
34 Ga0466692_053884 3300042591 Bacteria 1332
35 Ga0466691_067927 3300042593 Bacteria 8108
36 Ga0466694_324338 3300042594 Bacteria 2602
37 Ga0466715_227941 3300042616 Bacteria 4836
38 Ga0466723_035229 3300042618 Bacteria 16906
39 Ga0466723_042900 3300042618 Bacteria 3420
40 Ga0466726_412546 3300042619 Bacteria 1556
41 JGI24698J34947_10010863 3300002449 Bacteria 4996
42 JGI24695J34938_10005396 3300002450 Bacteria 7981
43 Ga0466729_200313 3300042621 Unclassified 1123
44 Ga0466704_533185 3300042643 Bacteria 78418
45 Ga0466707_312057 3300042601 Bacteria 1346
46 Ga0466716_108913 3300042605 Bacteria 11846
47 Ga0466716_274199 3300042605 Bacteria 1348
48 Ga0466719_077112 3300042606 Bacteria 68925
49 Ga0466722_040920 3300042609 Bacteria 2709
50 Ga0466690_101941 3300042590 Bacteria 8963
51 Ga0466690_222136 3300042590 Bacteria 2704
52 Ga0466692_048692 3300042591 Bacteria 4608
53 Ga0466694_058129 3300042594 Bacteria 3289
54 Ga0466696_193818 3300042596 Bacteria 2960
55 Ga0466696_404776 3300042596 Bacteria 12764
56 Ga0466711_122412 3300042615 Bacteria 3921
57 Ga0466711_227800 3300042615 Bacteria 12931
58 Ga0466715_093542 3300042616 Bacteria 9079
59 Ga0466715_588131 3300042616 Bacteria 26458
60 Ga0466723_020602 3300042618 Bacteria 4183
61 Ga0466726_073757 3300042619 Bacteria 1593
62 Ga0466726_142892 3300042619 Bacteria 1779
63 Ga0466726_212831 3300042619 Bacteria 1084
64 Ga0123356_10020001 3300010049 Bacteria 6340
65 JGI24698J34947_10000024 3300002449 Bacteria 40348
66 JGI24698J34947_10008828 3300002449 Bacteria 5530
67 Ga0466704_439686 3300042643 Bacteria 95559
68 Ga0466709_019100 3300042648 Bacteria 11750
69 Ga0466709_315520 3300042648 Bacteria 2190
70 Ga0466708_099906 3300042652 Bacteria 39915
71 Ga0466700_342590 3300042600 Bacteria 1106
72 Ga0466707_234504 3300042601 Unclassified 1026
73 Ga0466716_088475 3300042605 Bacteria 4992
74 Ga0456237_0007301 3300041968 Bacteria 1704
75 Ga0466690_097767 3300042590 Bacteria 7757
76 Ga0466705_500345 3300042612 Bacteria 7491
77 Ga0466711_253961 3300042615 Bacteria 28887
78 Ga0466711_410799 3300042615 Bacteria 6127
79 Ga0466715_328283 3300042616 Bacteria 2020
80 Ga0466718_052897 3300042617 Bacteria 8235
81 Ga0466723_050191 3300042618 Unclassified 2989
82 Ga0466728_172039 3300042620 Bacteria 5508
83 Ga0123354_10092849 3300010882 Bacteria 4153
84 AustNasuHG_c1004406 3300000089 Unclassified 5050
85 Ga0466703_316459 3300042636 Bacteria 1303
86 Ga0466709_129741 3300042648 Unclassified 4331
87 Ga0466713_081415 3300042602 Bacteria 3243
88 Ga0466719_104364 3300042606 Bacteria 6447
89 Ga0466719_428653 3300042606 Bacteria 24145
90 Ga0466722_200433 3300042609 Bacteria 2289
91 Ga0466690_215511 3300042590 Bacteria 15254
92 Ga0466692_094227 3300042591 Bacteria 1553
93 Ga0466692_176615 3300042591 Bacteria 15638
94 Ga0466691_070543 3300042593 Bacteria 8131
95 Ga0466696_349610 3300042596 Bacteria 15799
96 Ga0466705_441109 3300042612 Bacteria 11408
97 Ga0466711_350846 3300042615 Bacteria 8868
98 Ga0466715_124778 3300042616 Bacteria 6679
99 Ga0466715_495248 3300042616 Bacteria 5754
100 Ga0466718_115072 3300042617 Bacteria 2256
101 Ga0466723_319236 3300042618 Bacteria 2459
102 Ga0466726_190090 3300042619 Bacteria 3812
103 Ga0466726_320999 3300042619 Bacteria 21830
104 Ga0466728_032748 3300042620 Bacteria 22105
105 Ga0466705_287161 3300042612 Bacteria 2599
106 JGI24698J34947_10117181 3300002449 Unclassified 1163
107 Ga0466704_208436 3300042643 Bacteria 6504
108 Ga0466704_434098 3300042643 Bacteria 82573
109 Ga0466708_103476 3300042652 Bacteria 3584
110 Ga0466727_004655 3300042655 Bacteria 1950
111 Ga0466727_030956 3300042655 Bacteria 11790
112 Ga0466727_258877 3300042655 Bacteria 1320
113 Ga0466700_162342 3300042600 Bacteria 3104
114 Ga0466719_395167 3300042606 Bacteria 1764
115 Ga0466722_192535 3300042609 Bacteria 1411
116 Ga0466690_130357 3300042590 Bacteria 2286
117 Ga0466691_025561 3300042593 Bacteria 1283
118 Ga0466694_106389 3300042594 Bacteria 1853
119 Ga0466711_046942 3300042615 Bacteria 3347
120 Ga0466711_211388 3300042615 Bacteria 3744
121 Ga0466715_308389 3300042616 Bacteria 3518
122 Ga0466715_482398 3300042616 Bacteria 4888
123 Ga0466723_135180 3300042618 Bacteria 7369
124 Ga0466723_248039 3300042618 Bacteria 1989
125 Ga0466726_064957 3300042619 Unclassified 3018
126 Ga0123356_10108008 3300010049 Bacteria 2682
127 Ga0123356_10596647 3300010049 Bacteria 1269
128 Ga0123353_10047786 3300010167 Bacteria 6809
129 Ga0466705_269143 3300042612 Bacteria 16758
130 Ga0466703_311035 3300042636 Bacteria 10783
131 Ga0466709_001338 3300042648 Bacteria 5871
132 Ga0466708_007454 3300042652 Bacteria 7478
133 Ga0466708_126852 3300042652 Unclassified 4691
134 Ga0466727_103963 3300042655 Bacteria 1356
135 Ga0466719_350731 3300042606 Bacteria 7749
136 Ga0466722_187311 3300042609 Bacteria 1833
137 Ga0466690_194453 3300042590 Bacteria 24666
138 Ga0466690_255294 3300042590 Unclassified 7369
139 Ga0466690_342218 3300042590 Bacteria 6775
140 Ga0466692_002816 3300042591 Bacteria 3179
141 Ga0466691_184260 3300042593 Bacteria 1890
142 Ga0466696_080046 3300042596 Bacteria 3892
143 Ga0466715_050901 3300042616 Bacteria 6846
144 Ga0466715_073807 3300042616 Bacteria 13111
145 Ga0466715_196776 3300042616 Bacteria 8612
146 Ga0466723_022592 3300042618 Unclassified 2149
147 Ga0466728_071073 3300042620 Unclassified 2430
148 Ga0123356_10124440 3300010049 Bacteria 2514
149 Ga0466705_015926 3300042612 Bacteria 1667
150 FAAS_10001470 3300001880 Bacteria 1391
151 Ga0466703_122966 3300042636 Bacteria 6271
152 Ga0466703_204295 3300042636 Bacteria 43577
153 Ga0466704_147108 3300042643 Bacteria 2636
154 Ga0466704_285386 3300042643 Bacteria 59541
155 Ga0466708_086449 3300042652 Bacteria 3893
156 Ga0466708_277057 3300042652 Bacteria 8529
157 Ga0466708_310320 3300042652 Bacteria 19434
158 Ga0466713_109223 3300042602 Bacteria 1964
159 Ga0466719_015413 3300042606 Bacteria 14380
160 Ga0466719_569583 3300042606 Bacteria 2470
161 Ga0466720_185688 3300042607 Bacteria 11780
162 Ga0466722_138889 3300042609 Bacteria 1340
163 Ga0466722_211020 3300042609 Bacteria 2009
164 Ga0466722_220674 3300042609 Bacteria 6284
165 Ga0456237_0005672 3300041968 Bacteria 1976
166 Ga0466692_051706 3300042591 Bacteria 9375
167 Ga0466691_035269 3300042593 Bacteria 1257
168 Ga0466691_177068 3300042593 Bacteria 2041
169 Ga0466705_480956 3300042612 Bacteria 2861
170 Ga0466712_012783 3300042614 Bacteria 3866
171 Ga0466711_142177 3300042615 Bacteria 6546
172 Ga0466715_176108 3300042616 Bacteria 2826
173 Ga0466723_004455 3300042618 Bacteria 4320
174 Ga0466723_041927 3300042618 Bacteria 12042
175 Ga0123355_10001569 3300009826 Bacteria 31898
176 Ga0123356_10370491 3300010049 Bacteria 1562

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_500345 Ga0466705_500345_3180_4100 283
2 3300010049 Ga0123356_10370491 Ga0123356_103704912 285
3 3300042612 Ga0466705_269143 Ga0466705_269143_9039_9959 289
4 3300042643 Ga0466704_434098 Ga0466704_434098_67815_68735 289
5 3300010167 Ga0123353_10047786 Ga0123353_100477863 290
6 3300009826 Ga0123355_10001569 Ga0123355_1000156926 292
7 3300042636 Ga0466703_098539 Ga0466703_098539_1559_2479 299
8 3300042618 Ga0466723_020602 Ga0466723_020602_3136_4056 300
9 3300010049 Ga0123356_10108008 Ga0123356_101080082 302
10 3300042606 Ga0466719_015413 Ga0466719_015413_825_1751 303
11 3300042600 Ga0466700_162342 Ga0466700_162342_1962_2876 304
12 iso_pr_bacteria 2781125656 2781319774 304
13 3300042594 Ga0466694_324338 Ga0466694_324338_158_1075 305
14 3300042619 Ga0466726_412546 Ga0466726_412546_572_1489 305
15 iso_pr_bacteria 2781125664 2781340422 305
16 3300002450 JGI24695J34938_10005396 JGI24695J34938_100053964 306
17 3300010049 Ga0123356_10020001 Ga0123356_100200013 306
18 3300010049 Ga0123356_10596647 Ga0123356_105966471 306
19 3300041968 Ga0456237_0005672 Ga0456237_0005672_626_1546 306
20 3300041968 Ga0456237_0007301 Ga0456237_0007301_764_1684 306
21 3300042590 Ga0466690_097767 Ga0466690_097767_4644_5564 306
22 3300042590 Ga0466690_101941 Ga0466690_101941_1544_2464 306
23 3300042590 Ga0466690_130357 Ga0466690_130357_1293_2213 306
24 3300042590 Ga0466690_215511 Ga0466690_215511_5285_6205 306
25 3300042590 Ga0466690_222136 Ga0466690_222136_837_1757 306
26 3300042590 Ga0466690_255294 Ga0466690_255294_342_1262 306
27 3300042590 Ga0466690_342218 Ga0466690_342218_4043_4963 306
28 3300042591 Ga0466692_001517 Ga0466692_001517_340_1260 306
29 3300042591 Ga0466692_002816 Ga0466692_002816_619_1539 306
30 3300042591 Ga0466692_048692 Ga0466692_048692_810_1730 306
31 3300042591 Ga0466692_051706 Ga0466692_051706_4822_5742 306
32 3300042591 Ga0466692_053884 Ga0466692_053884_135_1055 306
33 3300042591 Ga0466692_176615 Ga0466692_176615_10853_11773 306
34 3300042593 Ga0466691_035269 Ga0466691_035269_202_1122 306
35 3300042593 Ga0466691_067927 Ga0466691_067927_71_991 306
36 3300042593 Ga0466691_070543 Ga0466691_070543_3573_4493 306
37 3300042593 Ga0466691_184260 Ga0466691_184260_74_994 306
38 3300042596 Ga0466696_080046 Ga0466696_080046_871_1791 306
39 3300042596 Ga0466696_193818 Ga0466696_193818_1559_2479 306
40 3300042596 Ga0466696_404776 Ga0466696_404776_1258_2178 306
41 3300042599 Ga0466706_151899 Ga0466706_151899_3330_4250 306
42 3300042601 Ga0466707_080480 Ga0466707_080480_93_1013 306
43 3300042601 Ga0466707_163217 Ga0466707_163217_3516_4436 306
44 3300042601 Ga0466707_234504 Ga0466707_234504_32_952 306
45 3300042601 Ga0466707_263373 Ga0466707_263373_265_1185 306
46 3300042601 Ga0466707_312057 Ga0466707_312057_414_1334 306
47 3300042602 Ga0466713_081415 Ga0466713_081415_736_1656 306
48 3300042602 Ga0466713_109223 Ga0466713_109223_540_1460 306
49 3300042605 Ga0466716_088475 Ga0466716_088475_2717_3637 306
50 3300042605 Ga0466716_108913 Ga0466716_108913_10909_11829 306
51 3300042605 Ga0466716_196998 Ga0466716_196998_729_1649 306
52 3300042605 Ga0466716_274199 Ga0466716_274199_123_1043 306
53 3300042606 Ga0466719_350731 Ga0466719_350731_4104_5024 306
54 3300042606 Ga0466719_424391 Ga0466719_424391_33_953 306
55 3300042606 Ga0466719_428653 Ga0466719_428653_11151_12071 306
56 3300042606 Ga0466719_430518 Ga0466719_430518_172_1092 306
57 3300042607 Ga0466720_185688 Ga0466720_185688_3487_4407 306
58 3300042609 Ga0466722_040920 Ga0466722_040920_1593_2513 306
59 3300042609 Ga0466722_107857 Ga0466722_107857_162_1082 306
60 3300042609 Ga0466722_138889 Ga0466722_138889_94_1014 306
61 3300042609 Ga0466722_187311 Ga0466722_187311_443_1363 306
62 3300042609 Ga0466722_192535 Ga0466722_192535_254_1174 306
63 3300042612 Ga0466705_015926 Ga0466705_015926_216_1136 306
64 3300042612 Ga0466705_287161 Ga0466705_287161_541_1461 306
65 3300042612 Ga0466705_441109 Ga0466705_441109_5453_6373 306
66 3300042612 Ga0466705_480956 Ga0466705_480956_373_1293 306
67 3300042615 Ga0466711_122412 Ga0466711_122412_1859_2779 306
68 3300042615 Ga0466711_142177 Ga0466711_142177_5177_6097 306
69 3300042615 Ga0466711_211388 Ga0466711_211388_2514_3434 306
70 3300042615 Ga0466711_227800 Ga0466711_227800_648_1568 306
71 3300042615 Ga0466711_253961 Ga0466711_253961_1871_2791 306
72 3300042615 Ga0466711_350846 Ga0466711_350846_2176_3096 306
73 3300042615 Ga0466711_410799 Ga0466711_410799_5026_5946 306
74 3300042616 Ga0466715_050901 Ga0466715_050901_5183_6103 306
75 3300042616 Ga0466715_073807 Ga0466715_073807_5288_6208 306
76 3300042616 Ga0466715_124778 Ga0466715_124778_951_1871 306
77 3300042616 Ga0466715_176108 Ga0466715_176108_309_1229 306
78 3300042616 Ga0466715_227941 Ga0466715_227941_2913_3833 306
79 3300042616 Ga0466715_308389 Ga0466715_308389_396_1316 306
80 3300042616 Ga0466715_328283 Ga0466715_328283_764_1684 306
81 3300042616 Ga0466715_329333 Ga0466715_329333_1338_2258 306
82 3300042616 Ga0466715_404673 Ga0466715_404673_1611_2531 306
83 3300042616 Ga0466715_482398 Ga0466715_482398_3509_4429 306
84 3300042616 Ga0466715_495248 Ga0466715_495248_3441_4361 306
85 3300042616 Ga0466715_588131 Ga0466715_588131_8652_9572 306
86 3300042617 Ga0466718_052897 Ga0466718_052897_5590_6510 306
87 3300042617 Ga0466718_115072 Ga0466718_115072_257_1177 306
88 3300042618 Ga0466723_004455 Ga0466723_004455_2725_3645 306
89 3300042618 Ga0466723_022592 Ga0466723_022592_336_1256 306
90 3300042618 Ga0466723_035229 Ga0466723_035229_12296_13216 306
91 3300042618 Ga0466723_041927 Ga0466723_041927_651_1571 306
92 3300042618 Ga0466723_042900 Ga0466723_042900_956_1876 306
93 3300042618 Ga0466723_050191 Ga0466723_050191_185_1105 306
94 3300042618 Ga0466723_135180 Ga0466723_135180_854_1774 306
95 3300042618 Ga0466723_248039 Ga0466723_248039_807_1727 306
96 3300042618 Ga0466723_319236 Ga0466723_319236_1323_2243 306
97 3300042619 Ga0466726_073757 Ga0466726_073757_203_1123 306
98 3300042619 Ga0466726_142892 Ga0466726_142892_815_1735 306
99 3300042619 Ga0466726_190090 Ga0466726_190090_2818_3738 306
100 3300042619 Ga0466726_212831 Ga0466726_212831_65_985 306
101 3300042619 Ga0466726_320999 Ga0466726_320999_12205_13125 306
102 3300042619 Ga0466726_373418 Ga0466726_373418_1577_2497 306
103 3300042619 Ga0466726_476171 Ga0466726_476171_528_1448 306
104 3300042620 Ga0466728_024517 Ga0466728_024517_19797_20717 306
105 3300042620 Ga0466728_032748 Ga0466728_032748_19618_20538 306
106 3300042620 Ga0466728_071073 Ga0466728_071073_1189_2109 306
107 3300042620 Ga0466728_140308 Ga0466728_140308_223_1143 306
108 3300042620 Ga0466728_172039 Ga0466728_172039_3940_4860 306
109 3300042621 Ga0466729_116417 Ga0466729_116417_63_983 306
110 3300042621 Ga0466729_125155 Ga0466729_125155_358_1278 306
111 3300042621 Ga0466729_200313 Ga0466729_200313_135_1055 306
112 3300042624 Ga0466735_010917 Ga0466735_010917_104_1024 306
113 3300042636 Ga0466703_122966 Ga0466703_122966_970_1890 306
114 3300042636 Ga0466703_158527 Ga0466703_158527_2464_3384 306
115 3300042636 Ga0466703_177672 Ga0466703_177672_212_1132 306
116 3300042636 Ga0466703_204295 Ga0466703_204295_27607_28527 306
117 3300042636 Ga0466703_316459 Ga0466703_316459_338_1258 306
118 3300042643 Ga0466704_147108 Ga0466704_147108_1315_2235 306
119 3300042643 Ga0466704_163745 Ga0466704_163745_576_1496 306
120 3300042643 Ga0466704_208436 Ga0466704_208436_500_1420 306
121 3300042643 Ga0466704_285386 Ga0466704_285386_12907_13827 306
122 3300042643 Ga0466704_533185 Ga0466704_533185_5888_6808 306
123 3300042648 Ga0466709_001338 Ga0466709_001338_4466_5386 306
124 3300042648 Ga0466709_129741 Ga0466709_129741_44_964 306
125 3300042648 Ga0466709_315520 Ga0466709_315520_775_1695 306
126 3300042652 Ga0466708_007454 Ga0466708_007454_5337_6257 306
127 3300042652 Ga0466708_086449 Ga0466708_086449_1330_2250 306
128 3300042652 Ga0466708_099906 Ga0466708_099906_20038_20958 306
129 3300042652 Ga0466708_103476 Ga0466708_103476_2164_3084 306
130 3300042652 Ga0466708_126852 Ga0466708_126852_3697_4617 306
131 3300042652 Ga0466708_274857 Ga0466708_274857_19933_20853 306
132 3300042652 Ga0466708_277057 Ga0466708_277057_1645_2565 306
133 3300042652 Ga0466708_298050 Ga0466708_298050_299_1219 306
134 3300042652 Ga0466708_310320 Ga0466708_310320_9169_10089 306
135 3300042655 Ga0466727_004655 Ga0466727_004655_622_1542 306
136 3300042655 Ga0466727_089824 Ga0466727_089824_128_1048 306
137 3300042655 Ga0466727_103963 Ga0466727_103963_244_1164 306
138 3300042655 Ga0466727_258877 Ga0466727_258877_188_1108 306
139 iso_pr_bacteria 650716102 650881125 306
140 3300000089 AustNasuHG_c1004406 AustNasuHG_10044063 307
141 3300001880 FAAS_10001470 FAAS_100014702 307
142 3300002449 JGI24698J34947_10000024 JGI24698J34947_1000002415 307
143 3300042591 Ga0466692_094227 Ga0466692_094227_144_1067 307
144 3300042593 Ga0466691_025561 Ga0466691_025561_264_1187 307
145 3300042594 Ga0466694_058129 Ga0466694_058129_155_1078 307
146 3300042594 Ga0466694_106389 Ga0466694_106389_686_1609 307
147 3300042600 Ga0466700_342590 Ga0466700_342590_121_1044 307
148 3300042606 Ga0466719_077112 Ga0466719_077112_66353_67276 307
149 3300042606 Ga0466719_104364 Ga0466719_104364_2980_3903 307
150 3300042606 Ga0466719_498100 Ga0466719_498100_470_1393 307
151 3300042609 Ga0466722_200433 Ga0466722_200433_603_1526 307
152 3300042609 Ga0466722_211020 Ga0466722_211020_232_1155 307
153 3300042609 Ga0466722_220674 Ga0466722_220674_3951_4874 307
154 3300042610 Ga0466698_434685 Ga0466698_434685_2044_2967 307
155 3300042616 Ga0466715_093542 Ga0466715_093542_7204_8127 307
156 3300042619 Ga0466726_064957 Ga0466726_064957_1775_2698 307
157 3300042636 Ga0466703_311035 Ga0466703_311035_9144_10067 307
158 3300042648 Ga0466709_387105 Ga0466709_387105_55_978 307
159 3300042655 Ga0466727_030956 Ga0466727_030956_1058_1981 307
160 3300002449 JGI24698J34947_10008828 JGI24698J34947_100088285 308
161 3300002449 JGI24698J34947_10010863 JGI24698J34947_100108635 308
162 3300002449 JGI24698J34947_10117181 JGI24698J34947_101171812 308
163 3300010049 Ga0123356_10124440 Ga0123356_101244402 308
164 3300002450 JGI24695J34938_10073105 JGI24695J34938_100731051 309
165 3300042616 Ga0466715_196776 Ga0466715_196776_360_1289 309
166 3300042643 Ga0466704_439686 Ga0466704_439686_6835_7767 310
167 3300010882 Ga0123354_10092849 Ga0123354_100928494 311
168 3300042614 Ga0466712_012783 Ga0466712_012783_2093_3028 311
169 3300042593 Ga0466691_177068 Ga0466691_177068_914_1852 312
170 3300042648 Ga0466709_291056 Ga0466709_291056_94_1032 312
171 3300042601 Ga0466707_073344 Ga0466707_073344_1249_2190 313
172 3300042615 Ga0466711_046942 Ga0466711_046942_1383_2330 315
173 3300042606 Ga0466719_569583 Ga0466719_569583_1256_2209 317
174 3300042619 Ga0466726_084190 Ga0466726_084190_351_1307 318
175 3300042648 Ga0466709_019100 Ga0466709_019100_5153_6112 319
176 3300042596 Ga0466696_349610 Ga0466696_349610_7773_8741 322
177 3300042606 Ga0466719_395167 Ga0466719_395167_323_1321 332
178 3300042590 Ga0466690_194453 Ga0466690_194453_19226_20233 335
179 3300042636 Ga0466703_037051 Ga0466703_037051_4940_5986 348

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00291 PALP Pyridoxal-phosphate dependent enzyme 7 288 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.74 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.