Protein Family IF06429

Metagenome Isolate
151 Members
91 Samples
124 Scaffolds
360.13 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_496101|Ga0466716_496101_4101_5282
Length
384 aa
Sequence
MEIKVQDDMASFFNEKGSLSQLIEKEFFIMKRKCLVSSLLASSYAAENVRFEPLIIQEQGSFAVGGTVVTTPGTFDPNNLIKPDGQTFHGDHAYVFYQVPVNPRKLPLVFLHGAGQFSKTWETTPDGRDGFQNIFLRRGFATYLLDQPRRGGAGRSTMPAELKPTADEQMWFTIFRLGNWPDFHPGVQFPQDEESLNQYFRQMTPNTGPYDDQVISDAIVALFDKLDDGILVTHSQGGGPGWYTAIKSAKVRAVISYEPGAFFFPEGEVPEPLPSSSPFGALKGVGVPMDDFLKLTKLPIVLYFGDNIPEEPTDDPGKDNWRTRLQMAKSWVAAINKHGGNAKLVHLPKIGITGNTHFPFSDLNNIEVADQMSKFLKENGLDSM

📊 Sample Types

Isolate 17.2%
Metagenome 82.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 15.2%
Formicidae 12.7%
Culicidae 12.7%
Armadillidiidae 10.1%
Termitidae 10.1%
Unclassified 8.9%
Drosophilidae 7.6%
Rhinotermitidae 5.1%
Curculionidae 5.1%
Elmidae 2.5%
Hydrophilidae 1.3%
Cerambycidae 1.3%
Carabidae 1.3%
Blattidae 1.3%
Passalidae 1.3%
Ceratophyllidae 1.3%
Gryllidae 1.3%
Termopsidae 1.3%

🌳 Taxonomy

Archaea 1
Bacteria 139
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
2 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
3 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
4 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
5 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
6 8100449422 Delftia sp. S66 Isolate Curculionidae
7 2864937364 Acidovorax soli S00198 Isolate Elmidae
8 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
11 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
12 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
18 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
19 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
20 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
21 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
22 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
23 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
24 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
27 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
31 2896321640 Sphingobacterium sp. xlx-130 Isolate
32 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
33 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
34 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
35 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
36 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
37 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
38 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
39 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
40 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
45 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
46 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
47 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
48 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
49 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
50 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
51 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
52 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
53 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
54 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
55 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
56 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
57 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
58 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
59 2898741527 Sphingobacterium sp. xlx-73 Isolate
60 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
61 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
62 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
63 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
64 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
65 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
66 8100455565 Delftia sp. S67 Isolate Curculionidae
67 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
68 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
69 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
70 2896330536 Sphingobacterium sp. xlx-96 Isolate
71 2978102237 Serratia fonticola AeS1 Isolate Culicidae
72 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
73 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
74 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
75 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
76 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
77 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
78 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
79 8100461708 Delftia sp. S65 Isolate Curculionidae
80 2896350215 Sphingobacterium sp. xlx-183 Isolate
81 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
82 2971189173 Yersinia pestis A-1249 Isolate Unclassified
83 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
84 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
85 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
86 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
87 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
88 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
89 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
90 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
91 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_048611 3300042612 Bacteria 2172
2 Ga0466711_192531 3300042615 Bacteria 6314
3 Ga0466711_406702 3300042615 Bacteria 3712
4 Ga0466711_477835 3300042615 Bacteria 3059
5 Ga0466715_119004 3300042616 Bacteria 2673
6 Ga0466715_256510 3300042616 Bacteria 2695
7 Ga0466726_087234 3300042619 Bacteria 1891
8 Ga0466700_111634 3300042600 Bacteria 2247
9 Ga0466713_100528 3300042602 Bacteria 510720
10 Ga0466716_496101 3300042605 Bacteria 7114
11 Ga0466719_151560 3300042606 Bacteria 7102
12 Ga0466729_308401 3300042621 Bacteria 1273
13 Ga0466708_116460 3300042652 Bacteria 6459
14 DPOL_contig20210 2035918003 Bacteria 53501
15 Ga0102735_1000262 3300007080 Unclassified 16310
16 Ga0104045_1018450 3300007085 Bacteria 5110
17 Ga0102739_1001194 3300007095 Bacteria 4388
18 Ga0160453_100040 3300012814 Bacteria 158320
19 Ga0160432_100022 3300012818 Bacteria 275704
20 Ga0160447_100031 3300012849 Bacteria 208699
21 Ga0160447_104748 3300012849 Bacteria 3941
22 Ga0160430_101735 3300012852 Bacteria 7685
23 Ga0466691_010774 3300042593 Bacteria 2742
24 Ga0466715_612489 3300042616 Bacteria 1808
25 Ga0466707_348963 3300042601 Bacteria 3897
26 Ga0466713_102643 3300042602 Bacteria 7951
27 Ga0466725_436653 3300042654 Bacteria 5842
28 IMNBL1DRAFT_c0004770 3300000062 Bacteria 8009
29 Ga0102740_1003012 3300007140 Bacteria 3704
30 Ga0104019_1000770 3300007150 Unclassified 16161
31 Ga0104050_1005622 3300007153 Unclassified 17389
32 Ga0160468_100104 3300012819 Bacteria 93524
33 Ga0160468_100143 3300012819 Bacteria 66884
34 Ga0160472_100619 3300012839 Unclassified 19032
35 Ga0160444_100164 3300012841 Bacteria 65564
36 Ga0160433_100384 3300012846 Unclassified 24917
37 Ga0160445_100536 3300012847 Bacteria 17766
38 Ga0316159_10001 3300030930 Bacteria 1642808
39 Ga0466711_400401 3300042615 Bacteria 7033
40 Ga0466715_323892 3300042616 Bacteria 8775
41 Ga0466729_039845 3300042621 Bacteria 14522
42 Ga0466713_033492 3300042602 Bacteria 93098
43 Ga0466722_066910 3300042609 Unclassified 1699
44 Ga0466729_270518 3300042621 Bacteria 2683
45 Ga0466703_189308 3300042636 Bacteria 4994
46 Ga0102736_1001693 3300007052 Bacteria 3752
47 Ga0104050_1000520 3300007153 Bacteria 4633
48 Ga0160445_100818 3300012847 Bacteria 11526
49 Ga0160443_108040 3300012848 Bacteria 1282
50 Ga0160448_100008 3300012854 Unclassified 336728
51 Ga0160457_1001732 3300012858 Unclassified 5508
52 Ga0466711_080735 3300042615 Bacteria 1374
53 Ga0466711_099625 3300042615 Bacteria 26383
54 Ga0466711_284903 3300042615 Bacteria 10999
55 Ga0466715_119065 3300042616 Bacteria 1597
56 Ga0466715_441291 3300042616 Bacteria 25941
57 Ga0466715_492111 3300042616 Bacteria 4125
58 Ga0160466_100062 3300012809 Bacteria 126237
59 Ga0466709_133004 3300042648 Bacteria 188114
60 Ga0466724_61835 3300042649 Bacteria 39158
61 Meta3P_1000043 3300002464 Bacteria 71817
62 CVPL005W_1000905 3300002934 Bacteria 9522
63 Ga0103264_1000505 3300007188 Bacteria 19921
64 Ga0160453_100551 3300012814 Unclassified 26483
65 Ga0160467_100445 3300012829 Bacteria 40999
66 Ga0160459_106696 3300012831 Bacteria 1468
67 Ga0160447_104228 3300012849 Bacteria 4319
68 Ga0466691_130499 3300042593 Bacteria 13435
69 Ga0466711_200938 3300042615 Bacteria 4343
70 Ga0466711_514205 3300042615 Bacteria 3190
71 Ga0466715_334520 3300042616 Bacteria 5441
72 Ga0466723_093681 3300042618 Bacteria 4854
73 Ga0466724_40452 3300042649 Bacteria 47603
74 JGI24698J34947_10031341 3300002449 Archaea 2799
75 Ga0104019_1001793 3300007150 Bacteria 2925
76 Ga0160453_100011 3300012814 Bacteria 295926
77 Ga0160441_100173 3300012825 Bacteria 70327
78 Ga0160467_100054 3300012829 Bacteria 169206
79 Ga0160446_100018 3300012835 Bacteria 242201
80 Ga0160445_100039 3300012847 Bacteria 164891
81 Ga0160443_103075 3300012848 Bacteria 3136
82 Ga0160434_100217 3300012850 Bacteria 26409
83 Ga0160435_1005400 3300012857 Bacteria 2899
84 Ga0466733_044548 3300042659 Bacteria 4007
85 Ga0466712_030131 3300042614 Bacteria 2046
86 Ga0466711_031297 3300042615 Bacteria 2820
87 Ga0466715_204289 3300042616 Bacteria 4203
88 Ga0466723_190017 3300042618 Bacteria 5808
89 Ga0160464_100009 3300012805 Bacteria 325341
90 Ga0466713_029419 3300042602 Bacteria 3503
91 Ga0466709_178426 3300042648 Bacteria 1428
92 Ga0103261_1000988 3300007083 Bacteria 4441
93 Ga0104048_1022297 3300007143 Bacteria 5092
94 Ga0160431_100002 3300012828 Bacteria 521722
95 Ga0160472_103041 3300012839 Bacteria 3487
96 Ga0160433_100016 3300012846 Bacteria 218010
97 Ga0160443_100041 3300012848 Bacteria 309778
98 Ga0466656_054032 3300042550 Bacteria 5906
99 Ga0466711_173727 3300042615 Bacteria 1992
100 Ga0466715_281004 3300042616 Bacteria 14784
101 Ga0466729_075532 3300042621 Bacteria 4438
102 Ga0466700_362165 3300042600 Bacteria 4813
103 Ga0466730_020669 3300042625 Bacteria 6226
104 Ga0466703_164075 3300042636 Bacteria 13137
105 Ga0466709_099793 3300042648 Bacteria 27054
106 CVPL010W_10011854 3300002931 Bacteria 7620
107 Ga0160469_101992 3300012824 Bacteria 4408
108 Ga0160435_1010757 3300012857 Unclassified 1888
109 Ga0466715_467199 3300042616 Bacteria 2718
110 Ga0466723_170548 3300042618 Bacteria 5741
111 Ga0466728_148666 3300042620 Bacteria 13542
112 Ga0466722_126837 3300042609 Bacteria 2538
113 Ga0466703_180221 3300042636 Bacteria 11765
114 Ga0466709_244883 3300042648 Bacteria 1308
115 Ga0466709_279049 3300042648 Bacteria 4105
116 Meta3P_1002960 3300002464 Unclassified 6481
117 Ga0103260_1001360 3300007139 Bacteria 4411
118 Ga0104050_1000136 3300007153 Bacteria 6824
119 Ga0104050_1001340 3300007153 Bacteria 2187
120 Ga0160447_101527 3300012849 Bacteria 8930
121 Ga0265387_1000062 3300024582 Bacteria 33660
122 Ga0466656_320484 3300042550 Bacteria 2543
123 Ga0466690_055692 3300042590 Bacteria 2129
124 Ga0466690_311136 3300042590 Bacteria 5324

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012831 Ga0160459_106696 Ga0160459_1066962 328
2 3300012854 Ga0160448_100008 Ga0160448_10000873 330
3 3300042602 Ga0466713_100528 Ga0466713_100528_172520_173620 330
4 3300042609 Ga0466722_126837 Ga0466722_126837_1165_2259 330
5 3300012814 Ga0160453_100040 Ga0160453_100040102 335
6 3300042615 Ga0466711_031297 Ga0466711_031297_232_1248 338
7 3300042615 Ga0466711_080735 Ga0466711_080735_145_1161 338
8 3300042615 Ga0466711_514205 Ga0466711_514205_244_1263 339
9 3300042616 Ga0466715_256510 Ga0466715_256510_1262_2338 339
10 3300042649 Ga0466724_61835 Ga0466724_61835_5832_6920 339
11 3300042648 Ga0466709_178426 Ga0466709_178426_304_1344 340
12 3300042616 Ga0466715_204289 Ga0466715_204289_69_1094 341
13 iso_pr_bacteria 2864761044 2864761198 341
14 3300012846 Ga0160433_100016 Ga0160433_100016107 342
15 3300042616 Ga0466715_492111 Ga0466715_492111_2515_3591 343
16 3300042615 Ga0466711_173727 Ga0466711_173727_94_1128 344
17 3300042615 Ga0466711_400401 Ga0466711_400401_2054_3130 347
18 3300012849 Ga0160447_104228 Ga0160447_1042284 349
19 3300002931 CVPL010W_10011854 CVPL010W_100118544 350
20 3300012839 Ga0160472_103041 Ga0160472_1030412 350
21 3300012857 Ga0160435_1010757 Ga0160435_10107573 350
22 3300042614 Ga0466712_030131 Ga0466712_030131_322_1374 350
23 3300042636 Ga0466703_164075 Ga0466703_164075_9331_10383 350
24 3300012824 Ga0160469_101992 Ga0160469_1019924 352
25 3300012846 Ga0160433_100384 Ga0160433_1003844 352
26 3300012847 Ga0160445_100536 Ga0160445_10053613 352
27 3300042550 Ga0466656_320484 Ga0466656_320484_1429_2490 353
28 2035918003 DPOL_contig20210 DPOLB_1531030 354
29 3300024582 Ga0265387_1000062 Ga0265387_100006225 354
30 3300042590 Ga0466690_055692 Ga0466690_055692_861_1925 354
31 3300042616 Ga0466715_323892 Ga0466715_323892_5922_6986 354
32 3300042625 Ga0466730_020669 Ga0466730_020669_4409_5473 354
33 iso_pr_bacteria 2519899622 2520387773 354
34 iso_pr_bacteria 2837516909 2837519767 354
35 iso_pr_bacteria 2847708326 2847710913 354
36 iso_pr_bacteria 2938192669 2938195150 354
37 iso_pr_bacteria 2978102237 2978103412 354
38 iso_pr_bacteria 3004010258 3004011557 354
39 iso_pr_bacteria 8004118532 8004119127 354
40 iso_pr_bacteria 8062647588 8062651424 354
41 3300002464 Meta3P_1002960 Meta3P_10029603 355
42 3300007150 Ga0104019_1001793 Ga0104019_10017934 355
43 3300012829 Ga0160467_100445 Ga0160467_10044529 355
44 3300042550 Ga0466656_054032 Ga0466656_054032_3084_4151 355
45 3300042654 Ga0466725_436653 Ga0466725_436653_912_1979 355
46 iso_pr_bacteria 2636416028 2638995722 355
47 3300007150 Ga0104019_1000770 Ga0104019_10007702 356
48 3300007153 Ga0104050_1000520 Ga0104050_10005202 356
49 3300012809 Ga0160466_100062 Ga0160466_10006266 356
50 3300042615 Ga0466711_099625 Ga0466711_099625_2807_3877 356
51 3300042616 Ga0466715_323892 Ga0466715_323892_1010_2080 356
52 3300042600 Ga0466700_111634 Ga0466700_111634_889_1962 357
53 3300042606 Ga0466719_151560 Ga0466719_151560_5507_6580 357
54 iso_pr_bacteria 2971189173 2971191614 357
55 iso_pr_bacteria 8006199443 8006202806 357
56 3300002464 Meta3P_1000043 Meta3P_10000434 358
57 3300007188 Ga0103264_1000505 Ga0103264_10005056 358
58 3300042600 Ga0466700_362165 Ga0466700_362165_605_1681 358
59 3300042615 Ga0466711_284903 Ga0466711_284903_8178_9254 358
60 3300042616 Ga0466715_281004 Ga0466715_281004_12508_13584 358
61 3300042616 Ga0466715_467199 Ga0466715_467199_1284_2360 358
62 3300042618 Ga0466723_170548 Ga0466723_170548_3503_4579 358
63 3300042618 Ga0466723_190017 Ga0466723_190017_1168_2244 358
64 3300042621 Ga0466729_308401 Ga0466729_308401_98_1174 358
65 3300042621 Ga0466729_039845 Ga0466729_039845_13411_14490 359
66 3300042621 Ga0466729_270518 Ga0466729_270518_1507_2586 359
67 3300002934 CVPL005W_1000905 CVPL005W_10009053 360
68 3300007153 Ga0104050_1001340 Ga0104050_10013402 360
69 3300012814 Ga0160453_100551 Ga0160453_10055113 360
70 3300012847 Ga0160445_100818 Ga0160445_1008185 360
71 3300012852 Ga0160430_101735 Ga0160430_1017355 360
72 3300012858 Ga0160457_1001732 Ga0160457_10017323 360
73 3300042612 Ga0466705_048611 Ga0466705_048611_541_1623 360
74 3300042616 Ga0466715_612489 Ga0466715_612489_71_1153 360
75 3300042619 Ga0466726_087234 Ga0466726_087234_555_1637 360
76 3300042659 Ga0466733_044548 Ga0466733_044548_83_1165 360
77 iso_pr_bacteria 2864937364 2864937511 360
78 3300012848 Ga0160443_100041 Ga0160443_100041246 361
79 3300042616 Ga0466715_119065 Ga0466715_119065_233_1318 361
80 iso_pr_bacteria 2830041218 2830044948 361
81 iso_pr_bacteria 2896321640 2896322057 361
82 iso_pr_bacteria 2896330536 2896333921 361
83 iso_pr_bacteria 2896350215 2896353459 361
84 iso_pr_bacteria 2898741527 2898742934 361
85 iso_pr_bacteria 2910942425 2910943039 361
86 3300012814 Ga0160453_100011 Ga0160453_100011115 362
87 3300012818 Ga0160432_100022 Ga0160432_100022142 362
88 3300012819 Ga0160468_100143 Ga0160468_10014327 362
89 3300012829 Ga0160467_100054 Ga0160467_10005496 362
90 3300012848 Ga0160443_103075 Ga0160443_1030753 362
91 3300012848 Ga0160443_108040 Ga0160443_1080401 362
92 3300042590 Ga0466690_311136 Ga0466690_311136_421_1509 362
93 3300042602 Ga0466713_033492 Ga0466713_033492_90071_91159 362
94 3300042615 Ga0466711_200938 Ga0466711_200938_1446_2534 362
95 3300042616 Ga0466715_119004 Ga0466715_119004_1543_2631 362
96 3300042636 Ga0466703_180221 Ga0466703_180221_6424_7512 362
97 3300042648 Ga0466709_133004 Ga0466709_133004_54520_55608 362
98 3300042648 Ga0466709_279049 Ga0466709_279049_2001_3089 362
99 3300042652 Ga0466708_116460 Ga0466708_116460_2575_3663 362
100 iso_pr_bacteria 2571042003 2571060959 362
101 3300007153 Ga0104050_1000136 Ga0104050_10001364 363
102 3300042615 Ga0466711_477835 Ga0466711_477835_324_1433 363
103 3300042616 Ga0466715_334520 Ga0466715_334520_2828_3919 363
104 3300042620 Ga0466728_148666 Ga0466728_148666_6007_7098 363
105 3300042621 Ga0466729_075532 Ga0466729_075532_113_1204 363
106 3300042648 Ga0466709_099793 Ga0466709_099793_6664_7755 363
107 iso_pr_bacteria 2873776654 2873781141 363
108 3300007052 Ga0102736_1001693 Ga0102736_10016933 364
109 3300007085 Ga0104045_1018450 Ga0104045_10184504 364
110 3300007095 Ga0102739_1001194 Ga0102739_10011942 364
111 3300007143 Ga0104048_1022297 Ga0104048_10222974 364
112 3300007153 Ga0104050_1005622 Ga0104050_10056224 364
113 3300002449 JGI24698J34947_10031341 JGI24698J34947_100313412 365
114 3300012847 Ga0160445_100039 Ga0160445_10003990 365
115 3300042609 Ga0466722_066910 Ga0466722_066910_258_1355 365
116 3300042636 Ga0466703_189308 Ga0466703_189308_1305_2402 365
117 3300012819 Ga0160468_100104 Ga0160468_10010487 366
118 3300012835 Ga0160446_100018 Ga0160446_100018208 366
119 3300012839 Ga0160472_100619 Ga0160472_10061916 366
120 3300012849 Ga0160447_100031 Ga0160447_100031175 366
121 3300042615 Ga0466711_192531 Ga0466711_192531_1796_2896 366
122 3300042616 Ga0466715_441291 Ga0466715_441291_20745_21845 366
123 3300012805 Ga0160464_100009 Ga0160464_10000959 367
124 3300042602 Ga0466713_102643 Ga0466713_102643_4846_5949 367
125 3300042648 Ga0466709_244883 Ga0466709_244883_112_1215 367
126 iso_pr_bacteria 8100166142 8100170938 367
127 3300012850 Ga0160434_100217 Ga0160434_10021728 369
128 3300042593 Ga0466691_010774 Ga0466691_010774_172_1281 369
129 3300007080 Ga0102735_1000262 Ga0102735_10002628 370
130 3300007083 Ga0103261_1000988 Ga0103261_10009882 370
131 3300012825 Ga0160441_100173 Ga0160441_10017326 370
132 3300030930 Ga0316159_10001 Ga0316159_10001742 370
133 3300000062 IMNBL1DRAFT_c0004770 IMNBL1DRAFT_00047707 371
134 3300007139 Ga0103260_1001360 Ga0103260_10013604 371
135 3300007140 Ga0102740_1003012 Ga0102740_10030123 371
136 3300042593 Ga0466691_130499 Ga0466691_130499_3861_4976 371
137 3300012828 Ga0160431_100002 Ga0160431_100002225 372
138 iso_pr_bacteria 3000478755 3000479170 379
139 3300042618 Ga0466723_093681 Ga0466723_093681_3247_4389 380
140 3300042649 Ga0466724_40452 Ga0466724_40452_44362_45504 380
141 3300042605 Ga0466716_496101 Ga0466716_496101_4101_5282 384
142 3300042615 Ga0466711_406702 Ga0466711_406702_244_1398 384
143 iso_pr_bacteria 8100449422 8100454826 384
144 iso_pr_bacteria 8100455565 8100456685 384
145 iso_pr_bacteria 8100461708 8100462218 384
146 3300042601 Ga0466707_348963 Ga0466707_348963_2060_3217 385
147 3300012841 Ga0160444_100164 Ga0160444_1001642 388
148 3300012849 Ga0160447_104748 Ga0160447_1047482 389
149 3300012857 Ga0160435_1005400 Ga0160435_10054003 389
150 3300042602 Ga0466713_029419 Ga0466713_029419_1283_2470 395
151 3300012849 Ga0160447_101527 Ga0160447_1015277 406

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 108 324 0.58

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.