Protein Family IF06409
Metagenome
Metatranscriptome
Isolate
245
Members
94
Samples
216
Scaffolds
95.98
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_397647|Ga0466716_397647_1851_2159
- Length
- 102 aa
- Sequence
- MRSKKMGIIIKPVITEKQTAITEKMPNRYGFRVSPNANKLEIKKAIEDMYGVTVTDVNTMRYSGKQKSRYTKSGFIHGRQASFKKAIIMLKKGDTIDFFSNI
Sample Types
Isolate
11.8%
Metagenome
87.8%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.2%
Blattidae
21.8%
Kalotermitidae
16.1%
Unclassified
9.2%
Termopsidae
4.6%
Passalidae
3.4%
Rhinotermitidae
3.4%
Culicidae
2.3%
Formicidae
2.3%
Armadillidiidae
2.3%
Hodotermitidae
1.1%
Bombycidae
1.1%
Taxonomy
Archaea
0
Bacteria
237
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 3 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 4 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 5 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 6 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 7 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 8 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 11 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 12 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 13 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 14 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 15 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 18 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 32 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 38 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 39 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 40 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 41 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 42 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 43 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 44 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 45 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 46 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 47 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 48 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 49 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 50 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 51 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 52 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 53 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 54 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 55 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 56 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 59 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 65 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 66 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 67 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 68 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 69 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 70 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 71 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 72 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 73 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 74 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 75 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 76 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 77 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 78 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 79 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 80 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 81 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 82 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 83 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 84 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 85 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 86 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 87 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 88 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 89 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 90 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 91 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 92 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 93 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 94 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_111418 | 3300042612 | Bacteria | 19183 |
| 2 | Ga0466733_003059 | 3300042659 | Bacteria | 1955 |
| 3 | Ga0466733_151623 | 3300042659 | Bacteria | 7663 |
| 4 | Ga0123355_11186386 | 3300009826 | Bacteria | 781 |
| 5 | Ga0123354_10320569 | 3300010882 | Bacteria | 1431 |
| 6 | Ga0466656_026647 | 3300042550 | Bacteria | 3538 |
| 7 | Ga0466656_151245 | 3300042550 | Bacteria | 1650 |
| 8 | Ga0466691_066359 | 3300042593 | Bacteria | 26336 |
| 9 | Ga0466734_041630 | 3300042623 | Unclassified | 1185 |
| 10 | Ga0466703_135901 | 3300042636 | Bacteria | 6825 |
| 11 | Ga0466703_398293 | 3300042636 | Bacteria | 4367 |
| 12 | Ga0466704_300185 | 3300042643 | Bacteria | 2837 |
| 13 | Ga0466708_254314 | 3300042652 | Bacteria | 24323 |
| 14 | Ga0466727_034636 | 3300042655 | Unclassified | 1447 |
| 15 | IMNBL1DRAFT_c0000677 | 3300000062 | Bacteria | 27305 |
| 16 | Ga0466711_095236 | 3300042615 | Bacteria | 15743 |
| 17 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 18 | Ga0466707_050052 | 3300042601 | Bacteria | 1867 |
| 19 | Ga0466707_098650 | 3300042601 | Bacteria | 10173 |
| 20 | Ga0466713_074513 | 3300042602 | Bacteria | 1881 |
| 21 | Ga0466716_248006 | 3300042605 | Bacteria | 34292 |
| 22 | Ga0466733_074430 | 3300042659 | Bacteria | 1143 |
| 23 | Ga0123357_10439421 | 3300009784 | Bacteria | 1144 |
| 24 | Ga0123355_10098764 | 3300009826 | Bacteria | 4603 |
| 25 | Ga0123353_10751070 | 3300010167 | Unclassified | 1358 |
| 26 | Ga0123354_10001124 | 3300010882 | Bacteria | 31160 |
| 27 | Ga0466690_085991 | 3300042590 | Bacteria | 12516 |
| 28 | Ga0466690_373916 | 3300042590 | Bacteria | 40566 |
| 29 | Ga0466693_419462 | 3300042592 | Bacteria | 2092 |
| 30 | Ga0466691_212240 | 3300042593 | Bacteria | 8980 |
| 31 | Ga0466696_053373 | 3300042596 | Bacteria | 10309 |
| 32 | Ga0466735_223099 | 3300042624 | Bacteria | 1230 |
| 33 | Ga0466703_367008 | 3300042636 | Bacteria | 30950 |
| 34 | Ga0466708_050057 | 3300042652 | Bacteria | 16124 |
| 35 | Ga0466727_016158 | 3300042655 | Bacteria | 3925 |
| 36 | Ga0466727_099262 | 3300042655 | Bacteria | 17474 |
| 37 | 2227098316 | 2225789004 | Bacteria | 1805 |
| 38 | IMNBL1DRAFT_c0132663 | 3300000062 | Bacteria | 648 |
| 39 | JGI24695J34938_10016383 | 3300002450 | Bacteria | 3770 |
| 40 | JGI24699J35502_11134150 | 3300002509 | Bacteria | 37878 |
| 41 | Ga0466710_099184 | 3300042613 | Bacteria | 2632 |
| 42 | Ga0466711_270694 | 3300042615 | Bacteria | 5695 |
| 43 | Ga0466715_119604 | 3300042616 | Bacteria | 22555 |
| 44 | Ga0466715_209992 | 3300042616 | Bacteria | 7477 |
| 45 | Ga0466715_332518 | 3300042616 | Bacteria | 5922 |
| 46 | Ga0466715_485900 | 3300042616 | Bacteria | 1894 |
| 47 | Ga0466723_082479 | 3300042618 | Bacteria | 5238 |
| 48 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 49 | Ga0466723_364306 | 3300042618 | Bacteria | 1322 |
| 50 | Ga0466726_069100 | 3300042619 | Bacteria | 5355 |
| 51 | Ga0466729_106187 | 3300042621 | Bacteria | 19633 |
| 52 | Ga0466713_026981 | 3300042602 | Bacteria | 6138 |
| 53 | Ga0466714_062448 | 3300042603 | Bacteria | 5091 |
| 54 | Ga0466719_093827 | 3300042606 | Bacteria | 3939 |
| 55 | Ga0466719_221547 | 3300042606 | Bacteria | 1078 |
| 56 | Ga0466722_253703 | 3300042609 | Bacteria | 9188 |
| 57 | Ga0466727_352642 | 3300042655 | Bacteria | 45291 |
| 58 | Ga0466732_073791 | 3300042656 | Bacteria | 2462 |
| 59 | Ga0123356_10264351 | 3300010049 | Bacteria | 1806 |
| 60 | Ga0123353_10336852 | 3300010167 | Bacteria | 2281 |
| 61 | Ga0123354_10467076 | 3300010882 | Bacteria | 1009 |
| 62 | Ga0160467_100137 | 3300012829 | Bacteria | 102655 |
| 63 | Ga0160443_100231 | 3300012848 | Bacteria | 61401 |
| 64 | Ga0466657_374169 | 3300042582 | Bacteria | 8157 |
| 65 | Ga0466690_313050 | 3300042590 | Bacteria | 12844 |
| 66 | Ga0466692_144683 | 3300042591 | Bacteria | 28602 |
| 67 | Ga0466693_216672 | 3300042592 | Bacteria | 7681 |
| 68 | Ga0466695_394828 | 3300042595 | Bacteria | 6915 |
| 69 | Ga0466696_424194 | 3300042596 | Bacteria | 2715 |
| 70 | Ga0466731_017732 | 3300042622 | Bacteria | 2469 |
| 71 | Ga0466704_214990 | 3300042643 | Bacteria | 3189 |
| 72 | Ga0466704_472759 | 3300042643 | Bacteria | 20123 |
| 73 | 2227523898 | 2225789004 | Bacteria | 654 |
| 74 | JGI24705J35276_11803109 | 3300002504 | Bacteria | 686 |
| 75 | JGI24696J40584_12948958 | 3300002834 | Bacteria | 2039 |
| 76 | Ga0466723_058528 | 3300042618 | Bacteria | 28595 |
| 77 | Ga0466723_085251 | 3300042618 | Bacteria | 1705 |
| 78 | Ga0466729_167874 | 3300042621 | Bacteria | 5275 |
| 79 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 80 | Ga0466706_128949 | 3300042599 | Bacteria | 3593 |
| 81 | Ga0466700_224480 | 3300042600 | Bacteria | 5875 |
| 82 | Ga0466707_335285 | 3300042601 | Bacteria | 3641 |
| 83 | Ga0466714_059082 | 3300042603 | Bacteria | 46712 |
| 84 | Ga0466716_484128 | 3300042605 | Bacteria | 1280 |
| 85 | Ga0466719_142182 | 3300042606 | Bacteria | 6280 |
| 86 | Ga0466719_183617 | 3300042606 | Bacteria | 2905 |
| 87 | Ga0466698_238828 | 3300042610 | Bacteria | 1092 |
| 88 | Ga0466733_172646 | 3300042659 | Bacteria | 1591 |
| 89 | Ga0123356_11372463 | 3300010049 | Bacteria | 868 |
| 90 | Ga0123356_11449971 | 3300010049 | Bacteria | 845 |
| 91 | Ga0123353_10000175 | 3300010167 | Bacteria | 81609 |
| 92 | Ga0265387_1020147 | 3300024582 | Bacteria | 992 |
| 93 | Ga0466694_017989 | 3300042594 | Bacteria | 1919 |
| 94 | Ga0466696_195859 | 3300042596 | Bacteria | 1912 |
| 95 | Ga0466699_085191 | 3300042597 | Bacteria | 1325 |
| 96 | Ga0466735_069140 | 3300042624 | Bacteria | 1119 |
| 97 | Ga0466735_171724 | 3300042624 | Bacteria | 1341 |
| 98 | Ga0466730_098534 | 3300042625 | Bacteria | 2323 |
| 99 | Ga0466704_055849 | 3300042643 | Bacteria | 53217 |
| 100 | Ga0466704_284171 | 3300042643 | Bacteria | 1002 |
| 101 | Ga0466704_313480 | 3300042643 | Bacteria | 1025 |
| 102 | Ga0466708_340350 | 3300042652 | Bacteria | 78722 |
| 103 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 104 | 2227109733 | 2225789004 | Bacteria | 1750 |
| 105 | CVPL010W_10000676 | 3300002931 | Bacteria | 64066 |
| 106 | Ga0102735_1006385 | 3300007080 | Bacteria | 1497 |
| 107 | Ga0123357_10000330 | 3300009784 | Bacteria | 44905 |
| 108 | Ga0466710_155200 | 3300042613 | Bacteria | 1375 |
| 109 | Ga0466711_047765 | 3300042615 | Bacteria | 35661 |
| 110 | Ga0466728_069680 | 3300042620 | Bacteria | 49538 |
| 111 | Ga0466728_189797 | 3300042620 | Unclassified | 1857 |
| 112 | Ga0466706_060424 | 3300042599 | Bacteria | 5778 |
| 113 | Ga0466707_020439 | 3300042601 | Bacteria | 3719 |
| 114 | Ga0466707_362963 | 3300042601 | Bacteria | 1588 |
| 115 | Ga0466717_257765 | 3300042604 | Bacteria | 1519 |
| 116 | Ga0466719_554685 | 3300042606 | Bacteria | 12056 |
| 117 | Ga0466733_059158 | 3300042659 | Bacteria | 4678 |
| 118 | Ga0123353_11426346 | 3300010167 | Unclassified | 888 |
| 119 | Ga0123353_11651944 | 3300010167 | Bacteria | 806 |
| 120 | Ga0123354_10025847 | 3300010882 | Bacteria | 9257 |
| 121 | Ga0160460_100068 | 3300012845 | Bacteria | 160857 |
| 122 | Ga0466690_156459 | 3300042590 | Bacteria | 1875 |
| 123 | Ga0466696_007662 | 3300042596 | Bacteria | 4151 |
| 124 | Ga0466696_367210 | 3300042596 | Bacteria | 9324 |
| 125 | Ga0466731_079923 | 3300042622 | Bacteria | 2667 |
| 126 | Ga0466734_009533 | 3300042623 | Bacteria | 1351 |
| 127 | Ga0466735_192190 | 3300042624 | Bacteria | 1213 |
| 128 | Ga0466709_126917 | 3300042648 | Bacteria | 6968 |
| 129 | 2226980356 | 2225789003 | Bacteria | 52405 |
| 130 | JGI24696J40584_12958524 | 3300002834 | Bacteria | 4212 |
| 131 | Ga0068302_10021091 | 3300005071 | Bacteria | 2178 |
| 132 | Ga0466705_474494 | 3300042612 | Bacteria | 1410 |
| 133 | Ga0466711_052952 | 3300042615 | Bacteria | 10990 |
| 134 | Ga0466711_212221 | 3300042615 | Bacteria | 10563 |
| 135 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 136 | Ga0466715_643493 | 3300042616 | Bacteria | 6621 |
| 137 | Ga0466723_348988 | 3300042618 | Bacteria | 4071 |
| 138 | Ga0466728_105299 | 3300042620 | Bacteria | 55474 |
| 139 | Ga0466728_163688 | 3300042620 | Bacteria | 3561 |
| 140 | Ga0466700_283150 | 3300042600 | Bacteria | 1374 |
| 141 | Ga0466707_354355 | 3300042601 | Bacteria | 49155 |
| 142 | Ga0466713_137191 | 3300042602 | Bacteria | 44160 |
| 143 | Ga0466733_028819 | 3300042659 | Bacteria | 27870 |
| 144 | Ga0123355_10378043 | 3300009826 | Unclassified | 1849 |
| 145 | Ga0123353_12502936 | 3300010167 | Bacteria | 614 |
| 146 | Ga0415639_075341 | 3300038395 | Bacteria | 3017 |
| 147 | Ga0466693_068969 | 3300042592 | Bacteria | 6191 |
| 148 | Ga0466735_234592 | 3300042624 | Bacteria | 1738 |
| 149 | Ga0466703_008913 | 3300042636 | Bacteria | 1764 |
| 150 | Ga0466703_060092 | 3300042636 | Bacteria | 6394 |
| 151 | Ga0466704_266068 | 3300042643 | Bacteria | 12383 |
| 152 | Ga0466704_284442 | 3300042643 | Unclassified | 1146 |
| 153 | Ga0466709_118201 | 3300042648 | Bacteria | 25211 |
| 154 | Ga0466709_129005 | 3300042648 | Bacteria | 13583 |
| 155 | Ga0466709_356044 | 3300042648 | Bacteria | 4031 |
| 156 | Ga0068302_10187713 | 3300005071 | Bacteria | 5235 |
| 157 | Ga0466711_011145 | 3300042615 | Bacteria | 2787 |
| 158 | Ga0466715_206964 | 3300042616 | Bacteria | 26549 |
| 159 | Ga0466726_144476 | 3300042619 | Bacteria | 21004 |
| 160 | Ga0466726_468513 | 3300042619 | Bacteria | 3456 |
| 161 | Ga0466707_194386 | 3300042601 | Bacteria | 27039 |
| 162 | Ga0466722_088834 | 3300042609 | Bacteria | 20099 |
| 163 | Ga0466733_010540 | 3300042659 | Bacteria | 1600 |
| 164 | Ga0123356_10896032 | 3300010049 | Bacteria | 1058 |
| 165 | Ga0160453_100102 | 3300012814 | Bacteria | 86683 |
| 166 | Ga0264413_144053 | 3300024493 | Bacteria | 4800 |
| 167 | Ga0466690_085259 | 3300042590 | Bacteria | 7863 |
| 168 | Ga0466692_188243 | 3300042591 | Bacteria | 86416 |
| 169 | Ga0466696_178778 | 3300042596 | Bacteria | 1756 |
| 170 | Ga0466729_202745 | 3300042621 | Bacteria | 2083 |
| 171 | Ga0466735_123775 | 3300042624 | Bacteria | 1810 |
| 172 | Ga0466703_174375 | 3300042636 | Bacteria | 10269 |
| 173 | Ga0466703_218903 | 3300042636 | Unclassified | 2204 |
| 174 | Ga0466709_406939 | 3300042648 | Bacteria | 144693 |
| 175 | 2227479986 | 2225789004 | Bacteria | 856 |
| 176 | IMNBL1DRAFT_c0000182 | 3300000062 | Bacteria | 55861 |
| 177 | Ga0068302_10124391 | 3300005071 | Bacteria | 2183 |
| 178 | Ga0068305_10005585 | 3300005083 | Bacteria | 21211 |
| 179 | Ga0068305_10166497 | 3300005083 | Bacteria | 2845 |
| 180 | Ga0068305_10722628 | 3300005083 | Bacteria | 1007 |
| 181 | Ga0074263_148548 | 3300005485 | Bacteria | 923 |
| 182 | Ga0466710_139034 | 3300042613 | Bacteria | 1529 |
| 183 | Ga0466711_511263 | 3300042615 | Bacteria | 3272 |
| 184 | Ga0466715_060059 | 3300042616 | Bacteria | 8464 |
| 185 | Ga0466715_324314 | 3300042616 | Bacteria | 25350 |
| 186 | Ga0466723_115974 | 3300042618 | Bacteria | 1073 |
| 187 | Ga0466719_449250 | 3300042606 | Bacteria | 4091 |
| 188 | Ga0466722_240663 | 3300042609 | Bacteria | 5357 |
| 189 | Ga0466698_378342 | 3300042610 | Bacteria | 2105 |
| 190 | Ga0466705_097898 | 3300042612 | Bacteria | 6160 |
| 191 | Ga0160471_100005 | 3300012812 | Bacteria | 554359 |
| 192 | Ga0233288_1207481 | 3300022232 | Bacteria | 745 |
| 193 | Ga0466690_248799 | 3300042590 | Bacteria | 9265 |
| 194 | Ga0466690_285786 | 3300042590 | Bacteria | 5108 |
| 195 | Ga0466694_118896 | 3300042594 | Bacteria | 1271 |
| 196 | Ga0466695_098130 | 3300042595 | Bacteria | 2069 |
| 197 | Ga0466729_225334 | 3300042621 | Bacteria | 1508 |
| 198 | Ga0466703_269865 | 3300042636 | Bacteria | 9316 |
| 199 | Ga0466703_329084 | 3300042636 | Bacteria | 2389 |
| 200 | Ga0466703_374219 | 3300042636 | Bacteria | 24808 |
| 201 | Ga0466704_004444 | 3300042643 | Bacteria | 24992 |
| 202 | Ga0466704_134293 | 3300042643 | Bacteria | 13368 |
| 203 | Ga0466709_400546 | 3300042648 | Bacteria | 20980 |
| 204 | Ga0466727_247918 | 3300042655 | Bacteria | 10698 |
| 205 | Ga0466711_172918 | 3300042615 | Bacteria | 1763 |
| 206 | Ga0466715_024383 | 3300042616 | Bacteria | 26866 |
| 207 | Ga0466715_266187 | 3300042616 | Bacteria | 25878 |
| 208 | Ga0466707_016303 | 3300042601 | Bacteria | 3178 |
| 209 | Ga0466713_052484 | 3300042602 | Bacteria | 51192 |
| 210 | Ga0466713_070338 | 3300042602 | Bacteria | 49717 |
| 211 | Ga0466716_397647 | 3300042605 | Bacteria | 6519 |
| 212 | Ga0466719_169958 | 3300042606 | Bacteria | 3797 |
| 213 | Ga0466719_414792 | 3300042606 | Bacteria | 1143 |
| 214 | Ga0466722_129428 | 3300042609 | Bacteria | 3744 |
| 215 | Ga0466722_175291 | 3300042609 | Bacteria | 6835 |
| 216 | Ga0466698_196902 | 3300042610 | Bacteria | 1289 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042592 | Ga0466693_068969 | Ga0466693_068969_1416_1661 | 81 |
| 2 | 3300002450 | JGI24695J34938_10016383 | JGI24695J34938_100163835 | 82 |
| 3 | 3300007080 | Ga0102735_1006385 | Ga0102735_10063852 | 84 |
| 4 | 3300042550 | Ga0466656_026647 | Ga0466656_026647_2537_2791 | 84 |
| 5 | 3300042550 | Ga0466656_151245 | Ga0466656_151245_1181_1435 | 84 |
| 6 | 3300042582 | Ga0466657_374169 | Ga0466657_374169_6949_7203 | 84 |
| 7 | 3300042594 | Ga0466694_017989 | Ga0466694_017989_1187_1441 | 84 |
| 8 | 3300042603 | Ga0466714_059082 | Ga0466714_059082_7306_7560 | 84 |
| 9 | 3300042610 | Ga0466698_196902 | Ga0466698_196902_444_698 | 84 |
| 10 | 3300042624 | Ga0466735_171724 | Ga0466735_171724_695_949 | 84 |
| 11 | 3300009826 | Ga0123355_10098764 | Ga0123355_100987643 | 85 |
| 12 | 3300010167 | Ga0123353_12502936 | Ga0123353_125029362 | 85 |
| 13 | 3300010882 | Ga0123354_10320569 | Ga0123354_103205693 | 85 |
| 14 | 3300012845 | Ga0160460_100068 | Ga0160460_1000683 | 88 |
| 15 | 3300012812 | Ga0160471_100005 | Ga0160471_100005179 | 89 |
| 16 | 3300038395 | Ga0415639_075341 | Ga0415639_075341_1705_1974 | 89 |
| 17 | 3300042595 | Ga0466695_394828 | Ga0466695_394828_259_528 | 89 |
| 18 | 3300042597 | Ga0466699_085191 | Ga0466699_085191_1016_1285 | 89 |
| 19 | 3300042600 | Ga0466700_283150 | Ga0466700_283150_201_470 | 89 |
| 20 | 3300042623 | Ga0466734_041630 | Ga0466734_041630_257_526 | 89 |
| 21 | 3300042659 | Ga0466733_059158 | Ga0466733_059158_2035_2304 | 89 |
| 22 | 3300042659 | Ga0466733_151623 | Ga0466733_151623_1118_1387 | 89 |
| 23 | 3300010167 | Ga0123353_10000175 | Ga0123353_1000017545 | 90 |
| 24 | 3300010167 | Ga0123353_11426346 | Ga0123353_114263462 | 90 |
| 25 | 3300012814 | Ga0160453_100102 | Ga0160453_10010217 | 90 |
| 26 | 3300022232 | Ga0233288_1207481 | Ga0233288_12074812 | 96 |
| 27 | 3300024493 | Ga0264413_144053 | Ga0264413_1440534 | 96 |
| 28 | 3300042590 | Ga0466690_313050 | Ga0466690_313050_5498_5788 | 96 |
| 29 | 3300042603 | Ga0466714_062448 | Ga0466714_062448_4653_4943 | 96 |
| 30 | 3300042606 | Ga0466719_142182 | Ga0466719_142182_2224_2514 | 96 |
| 31 | 3300042610 | Ga0466698_378342 | Ga0466698_378342_538_828 | 96 |
| 32 | 3300042613 | Ga0466710_155200 | Ga0466710_155200_44_334 | 96 |
| 33 | 3300042615 | Ga0466711_047765 | Ga0466711_047765_10920_11210 | 96 |
| 34 | 3300042620 | Ga0466728_189797 | Ga0466728_189797_401_691 | 96 |
| 35 | 3300042622 | Ga0466731_017732 | Ga0466731_017732_1962_2252 | 96 |
| 36 | 3300042648 | Ga0466709_406939 | Ga0466709_406939_128821_129111 | 96 |
| 37 | 3300042659 | Ga0466733_003059 | Ga0466733_003059_334_624 | 96 |
| 38 | iso_pr_bacteria | 2579779088 | 2582239281 | 96 |
| 39 | iso_pr_bacteria | 2820746860 | 2820747474 | 96 |
| 40 | iso_pr_bacteria | 2820770630 | 2820771396 | 96 |
| 41 | iso_pr_bacteria | 2820785563 | 2820786943 | 96 |
| 42 | iso_pr_bacteria | 2820788205 | 2820789841 | 96 |
| 43 | iso_pr_bacteria | 2896321640 | 2896323946 | 96 |
| 44 | iso_pr_bacteria | 2896330536 | 2896332515 | 96 |
| 45 | iso_pr_bacteria | 2896350215 | 2896352327 | 96 |
| 46 | iso_pr_bacteria | 2898741527 | 2898744271 | 96 |
| 47 | 2225789003 | 2226980356 | 2227324181 | 97 |
| 48 | 2225789004 | 2227098316 | 2227480650 | 97 |
| 49 | 2225789004 | 2227109733 | 2227498073 | 97 |
| 50 | 2225789004 | 2227479986 | 2227936934 | 97 |
| 51 | 2225789004 | 2227523898 | 2228029788 | 97 |
| 52 | 3300002931 | CVPL010W_10000676 | CVPL010W_1000067616 | 97 |
| 53 | 3300005485 | Ga0074263_148548 | Ga0074263_1485482 | 97 |
| 54 | 3300009826 | Ga0123355_11186386 | Ga0123355_111863861 | 97 |
| 55 | 3300010049 | Ga0123356_10264351 | Ga0123356_102643512 | 97 |
| 56 | 3300010049 | Ga0123356_11449971 | Ga0123356_114499712 | 97 |
| 57 | 3300010167 | Ga0123353_10336852 | Ga0123353_103368524 | 97 |
| 58 | 3300010167 | Ga0123353_10751070 | Ga0123353_107510702 | 97 |
| 59 | 3300010882 | Ga0123354_10467076 | Ga0123354_104670763 | 97 |
| 60 | 3300012848 | Ga0160443_100231 | Ga0160443_10023136 | 97 |
| 61 | 3300024582 | Ga0265387_1020147 | Ga0265387_10201471 | 97 |
| 62 | 3300042590 | Ga0466690_085259 | Ga0466690_085259_1350_1643 | 97 |
| 63 | 3300042590 | Ga0466690_085991 | Ga0466690_085991_11746_12039 | 97 |
| 64 | 3300042590 | Ga0466690_156459 | Ga0466690_156459_714_1007 | 97 |
| 65 | 3300042590 | Ga0466690_248799 | Ga0466690_248799_4246_4539 | 97 |
| 66 | 3300042590 | Ga0466690_285786 | Ga0466690_285786_1121_1414 | 97 |
| 67 | 3300042590 | Ga0466690_373916 | Ga0466690_373916_7118_7411 | 97 |
| 68 | 3300042591 | Ga0466692_144683 | Ga0466692_144683_19670_19963 | 97 |
| 69 | 3300042591 | Ga0466692_188243 | Ga0466692_188243_42221_42514 | 97 |
| 70 | 3300042592 | Ga0466693_216672 | Ga0466693_216672_4277_4570 | 97 |
| 71 | 3300042592 | Ga0466693_419462 | Ga0466693_419462_102_395 | 97 |
| 72 | 3300042593 | Ga0466691_066359 | Ga0466691_066359_17494_17787 | 97 |
| 73 | 3300042594 | Ga0466694_118896 | Ga0466694_118896_791_1084 | 97 |
| 74 | 3300042595 | Ga0466695_098130 | Ga0466695_098130_1130_1423 | 97 |
| 75 | 3300042596 | Ga0466696_053373 | Ga0466696_053373_4591_4884 | 97 |
| 76 | 3300042596 | Ga0466696_195859 | Ga0466696_195859_1422_1715 | 97 |
| 77 | 3300042596 | Ga0466696_367210 | Ga0466696_367210_5244_5537 | 97 |
| 78 | 3300042596 | Ga0466696_424194 | Ga0466696_424194_140_433 | 97 |
| 79 | 3300042599 | Ga0466706_060424 | Ga0466706_060424_1718_2011 | 97 |
| 80 | 3300042599 | Ga0466706_123047 | Ga0466706_123047_29170_29463 | 97 |
| 81 | 3300042599 | Ga0466706_128949 | Ga0466706_128949_910_1203 | 97 |
| 82 | 3300042600 | Ga0466700_224480 | Ga0466700_224480_1263_1556 | 97 |
| 83 | 3300042601 | Ga0466707_016303 | Ga0466707_016303_1826_2119 | 97 |
| 84 | 3300042601 | Ga0466707_020439 | Ga0466707_020439_2323_2616 | 97 |
| 85 | 3300042601 | Ga0466707_050052 | Ga0466707_050052_627_920 | 97 |
| 86 | 3300042601 | Ga0466707_098650 | Ga0466707_098650_7431_7724 | 97 |
| 87 | 3300042601 | Ga0466707_194386 | Ga0466707_194386_5655_5948 | 97 |
| 88 | 3300042601 | Ga0466707_335285 | Ga0466707_335285_749_1042 | 97 |
| 89 | 3300042601 | Ga0466707_354355 | Ga0466707_354355_16077_16370 | 97 |
| 90 | 3300042601 | Ga0466707_362963 | Ga0466707_362963_547_840 | 97 |
| 91 | 3300042602 | Ga0466713_026981 | Ga0466713_026981_4677_4970 | 97 |
| 92 | 3300042602 | Ga0466713_052484 | Ga0466713_052484_43583_43876 | 97 |
| 93 | 3300042602 | Ga0466713_070338 | Ga0466713_070338_29430_29723 | 97 |
| 94 | 3300042602 | Ga0466713_074513 | Ga0466713_074513_577_870 | 97 |
| 95 | 3300042602 | Ga0466713_137191 | Ga0466713_137191_13359_13652 | 97 |
| 96 | 3300042604 | Ga0466717_257765 | Ga0466717_257765_50_343 | 97 |
| 97 | 3300042605 | Ga0466716_248006 | Ga0466716_248006_15650_15943 | 97 |
| 98 | 3300042605 | Ga0466716_484128 | Ga0466716_484128_187_480 | 97 |
| 99 | 3300042606 | Ga0466719_093827 | Ga0466719_093827_1688_1981 | 97 |
| 100 | 3300042606 | Ga0466719_169958 | Ga0466719_169958_252_545 | 97 |
| 101 | 3300042606 | Ga0466719_183617 | Ga0466719_183617_1689_1982 | 97 |
| 102 | 3300042606 | Ga0466719_221547 | Ga0466719_221547_628_921 | 97 |
| 103 | 3300042606 | Ga0466719_414792 | Ga0466719_414792_481_774 | 97 |
| 104 | 3300042606 | Ga0466719_449250 | Ga0466719_449250_1728_2021 | 97 |
| 105 | 3300042606 | Ga0466719_554685 | Ga0466719_554685_6274_6567 | 97 |
| 106 | 3300042609 | Ga0466722_088834 | Ga0466722_088834_13636_13929 | 97 |
| 107 | 3300042609 | Ga0466722_129428 | Ga0466722_129428_13_306 | 97 |
| 108 | 3300042609 | Ga0466722_175291 | Ga0466722_175291_5563_5856 | 97 |
| 109 | 3300042609 | Ga0466722_240663 | Ga0466722_240663_2453_2746 | 97 |
| 110 | 3300042610 | Ga0466698_238828 | Ga0466698_238828_15_308 | 97 |
| 111 | 3300042612 | Ga0466705_097898 | Ga0466705_097898_3534_3827 | 97 |
| 112 | 3300042612 | Ga0466705_111418 | Ga0466705_111418_13881_14174 | 97 |
| 113 | 3300042612 | Ga0466705_474494 | Ga0466705_474494_1022_1315 | 97 |
| 114 | 3300042613 | Ga0466710_099184 | Ga0466710_099184_1583_1876 | 97 |
| 115 | 3300042615 | Ga0466711_011145 | Ga0466711_011145_1192_1485 | 97 |
| 116 | 3300042615 | Ga0466711_052952 | Ga0466711_052952_7503_7796 | 97 |
| 117 | 3300042615 | Ga0466711_095236 | Ga0466711_095236_5606_5899 | 97 |
| 118 | 3300042615 | Ga0466711_120016 | Ga0466711_120016_27564_27857 | 97 |
| 119 | 3300042615 | Ga0466711_172918 | Ga0466711_172918_1260_1553 | 97 |
| 120 | 3300042615 | Ga0466711_212221 | Ga0466711_212221_426_719 | 97 |
| 121 | 3300042615 | Ga0466711_270694 | Ga0466711_270694_4394_4687 | 97 |
| 122 | 3300042615 | Ga0466711_289238 | Ga0466711_289238_38466_38759 | 97 |
| 123 | 3300042615 | Ga0466711_511263 | Ga0466711_511263_918_1211 | 97 |
| 124 | 3300042616 | Ga0466715_024383 | Ga0466715_024383_2485_2778 | 97 |
| 125 | 3300042616 | Ga0466715_060059 | Ga0466715_060059_6037_6330 | 97 |
| 126 | 3300042616 | Ga0466715_119604 | Ga0466715_119604_15519_15812 | 97 |
| 127 | 3300042616 | Ga0466715_206964 | Ga0466715_206964_2135_2428 | 97 |
| 128 | 3300042616 | Ga0466715_209992 | Ga0466715_209992_3228_3521 | 97 |
| 129 | 3300042616 | Ga0466715_266187 | Ga0466715_266187_1634_1927 | 97 |
| 130 | 3300042616 | Ga0466715_324314 | Ga0466715_324314_5813_6106 | 97 |
| 131 | 3300042616 | Ga0466715_332518 | Ga0466715_332518_2408_2701 | 97 |
| 132 | 3300042616 | Ga0466715_485900 | Ga0466715_485900_1329_1622 | 97 |
| 133 | 3300042616 | Ga0466715_643493 | Ga0466715_643493_5438_5731 | 97 |
| 134 | 3300042618 | Ga0466723_058528 | Ga0466723_058528_14970_15263 | 97 |
| 135 | 3300042618 | Ga0466723_082479 | Ga0466723_082479_3237_3530 | 97 |
| 136 | 3300042618 | Ga0466723_085251 | Ga0466723_085251_738_1031 | 97 |
| 137 | 3300042618 | Ga0466723_093881 | Ga0466723_093881_6134_6427 | 97 |
| 138 | 3300042618 | Ga0466723_115974 | Ga0466723_115974_595_888 | 97 |
| 139 | 3300042618 | Ga0466723_348988 | Ga0466723_348988_2810_3103 | 97 |
| 140 | 3300042618 | Ga0466723_364306 | Ga0466723_364306_99_392 | 97 |
| 141 | 3300042619 | Ga0466726_069100 | Ga0466726_069100_1793_2086 | 97 |
| 142 | 3300042619 | Ga0466726_144476 | Ga0466726_144476_14374_14667 | 97 |
| 143 | 3300042619 | Ga0466726_468513 | Ga0466726_468513_3065_3358 | 97 |
| 144 | 3300042620 | Ga0466728_069680 | Ga0466728_069680_26863_27156 | 97 |
| 145 | 3300042620 | Ga0466728_105299 | Ga0466728_105299_32437_32730 | 97 |
| 146 | 3300042620 | Ga0466728_163688 | Ga0466728_163688_574_867 | 97 |
| 147 | 3300042621 | Ga0466729_106187 | Ga0466729_106187_13943_14236 | 97 |
| 148 | 3300042621 | Ga0466729_167874 | Ga0466729_167874_1251_1544 | 97 |
| 149 | 3300042621 | Ga0466729_202745 | Ga0466729_202745_874_1167 | 97 |
| 150 | 3300042621 | Ga0466729_225334 | Ga0466729_225334_1176_1469 | 97 |
| 151 | 3300042622 | Ga0466731_079923 | Ga0466731_079923_181_474 | 97 |
| 152 | 3300042623 | Ga0466734_009533 | Ga0466734_009533_665_958 | 97 |
| 153 | 3300042624 | Ga0466735_069140 | Ga0466735_069140_357_650 | 97 |
| 154 | 3300042624 | Ga0466735_123775 | Ga0466735_123775_572_865 | 97 |
| 155 | 3300042624 | Ga0466735_192190 | Ga0466735_192190_343_636 | 97 |
| 156 | 3300042624 | Ga0466735_223099 | Ga0466735_223099_558_851 | 97 |
| 157 | 3300042624 | Ga0466735_234592 | Ga0466735_234592_1415_1708 | 97 |
| 158 | 3300042625 | Ga0466730_098534 | Ga0466730_098534_71_364 | 97 |
| 159 | 3300042636 | Ga0466703_008913 | Ga0466703_008913_754_1047 | 97 |
| 160 | 3300042636 | Ga0466703_060092 | Ga0466703_060092_4006_4299 | 97 |
| 161 | 3300042636 | Ga0466703_135901 | Ga0466703_135901_4931_5224 | 97 |
| 162 | 3300042636 | Ga0466703_174375 | Ga0466703_174375_3493_3786 | 97 |
| 163 | 3300042636 | Ga0466703_218903 | Ga0466703_218903_1692_1985 | 97 |
| 164 | 3300042636 | Ga0466703_269865 | Ga0466703_269865_4017_4310 | 97 |
| 165 | 3300042636 | Ga0466703_329084 | Ga0466703_329084_1602_1895 | 97 |
| 166 | 3300042636 | Ga0466703_367008 | Ga0466703_367008_18777_19070 | 97 |
| 167 | 3300042636 | Ga0466703_374219 | Ga0466703_374219_11485_11778 | 97 |
| 168 | 3300042636 | Ga0466703_398293 | Ga0466703_398293_2121_2414 | 97 |
| 169 | 3300042643 | Ga0466704_004444 | Ga0466704_004444_15872_16165 | 97 |
| 170 | 3300042643 | Ga0466704_055849 | Ga0466704_055849_38980_39273 | 97 |
| 171 | 3300042643 | Ga0466704_134293 | Ga0466704_134293_12412_12705 | 97 |
| 172 | 3300042643 | Ga0466704_214990 | Ga0466704_214990_2376_2669 | 97 |
| 173 | 3300042643 | Ga0466704_266068 | Ga0466704_266068_7474_7767 | 97 |
| 174 | 3300042643 | Ga0466704_284171 | Ga0466704_284171_432_725 | 97 |
| 175 | 3300042643 | Ga0466704_284442 | Ga0466704_284442_575_868 | 97 |
| 176 | 3300042643 | Ga0466704_300185 | Ga0466704_300185_482_775 | 97 |
| 177 | 3300042643 | Ga0466704_313480 | Ga0466704_313480_613_906 | 97 |
| 178 | 3300042643 | Ga0466704_472759 | Ga0466704_472759_3211_3504 | 97 |
| 179 | 3300042648 | Ga0466709_118201 | Ga0466709_118201_19149_19442 | 97 |
| 180 | 3300042648 | Ga0466709_126917 | Ga0466709_126917_6585_6878 | 97 |
| 181 | 3300042648 | Ga0466709_129005 | Ga0466709_129005_9976_10269 | 97 |
| 182 | 3300042648 | Ga0466709_356044 | Ga0466709_356044_1327_1620 | 97 |
| 183 | 3300042648 | Ga0466709_400546 | Ga0466709_400546_18437_18730 | 97 |
| 184 | 3300042652 | Ga0466708_050057 | Ga0466708_050057_1395_1688 | 97 |
| 185 | 3300042652 | Ga0466708_254314 | Ga0466708_254314_6769_7062 | 97 |
| 186 | 3300042652 | Ga0466708_340350 | Ga0466708_340350_59729_60022 | 97 |
| 187 | 3300042655 | Ga0466727_016158 | Ga0466727_016158_1522_1815 | 97 |
| 188 | 3300042655 | Ga0466727_034636 | Ga0466727_034636_127_420 | 97 |
| 189 | 3300042655 | Ga0466727_040337 | Ga0466727_040337_22151_22444 | 97 |
| 190 | 3300042655 | Ga0466727_099262 | Ga0466727_099262_4948_5241 | 97 |
| 191 | 3300042655 | Ga0466727_247918 | Ga0466727_247918_1727_2020 | 97 |
| 192 | 3300042655 | Ga0466727_352642 | Ga0466727_352642_13470_13763 | 97 |
| 193 | 3300042656 | Ga0466732_073791 | Ga0466732_073791_641_934 | 97 |
| 194 | 3300042659 | Ga0466733_010540 | Ga0466733_010540_607_900 | 97 |
| 195 | 3300042659 | Ga0466733_028819 | Ga0466733_028819_22446_22739 | 97 |
| 196 | 3300042659 | Ga0466733_074430 | Ga0466733_074430_728_1021 | 97 |
| 197 | 3300042659 | Ga0466733_172646 | Ga0466733_172646_310_603 | 97 |
| 198 | iso_pr_bacteria | 2820762746 | 2820764339 | 97 |
| 199 | iso_pr_bacteria | 2940195863 | 2940197453 | 97 |
| 200 | iso_pr_bacteria | 2940199050 | 2940199578 | 97 |
| 201 | iso_pr_bacteria | 2940202316 | 2940204395 | 97 |
| 202 | iso_pr_bacteria | 2940205530 | 2940208415 | 97 |
| 203 | iso_pr_bacteria | 2940209341 | 2940209445 | 97 |
| 204 | iso_pr_bacteria | 2940212447 | 2940215383 | 97 |
| 205 | iso_pr_bacteria | 2940216256 | 2940217615 | 97 |
| 206 | iso_pr_bacteria | 2940298504 | 2940301437 | 97 |
| 207 | iso_pr_bacteria | 2940302308 | 2940305239 | 97 |
| 208 | iso_pr_bacteria | 2940306115 | 2940309002 | 97 |
| 209 | iso_pr_bacteria | 2940309933 | 2940312895 | 97 |
| 210 | iso_pr_bacteria | 2940313741 | 2940316708 | 97 |
| 211 | iso_pr_bacteria | 2940317558 | 2940320523 | 97 |
| 212 | iso_pr_bacteria | 2940321370 | 2940324279 | 97 |
| 213 | iso_pr_bacteria | 2940325180 | 2940328055 | 97 |
| 214 | iso_pr_bacteria | 2940328985 | 2940331916 | 97 |
| 215 | iso_pr_bacteria | 2940332795 | 2940335760 | 97 |
| 216 | iso_pr_bacteria | 2940346213 | 2940347093 | 97 |
| 217 | iso_pr_bacteria | 2940371297 | 2940373371 | 97 |
| 218 | 3300000062 | IMNBL1DRAFT_c0000182 | IMNBL1DRAFT_000018250 | 98 |
| 219 | 3300000062 | IMNBL1DRAFT_c0000677 | IMNBL1DRAFT_000067744 | 98 |
| 220 | 3300000062 | IMNBL1DRAFT_c0132663 | IMNBL1DRAFT_01326632 | 98 |
| 221 | 3300002504 | JGI24705J35276_11803109 | JGI24705J35276_118031092 | 98 |
| 222 | 3300002509 | JGI24699J35502_11134150 | JGI24699J35502_1113415042 | 98 |
| 223 | 3300002834 | JGI24696J40584_12948958 | JGI24696J40584_129489583 | 98 |
| 224 | 3300002834 | JGI24696J40584_12958524 | JGI24696J40584_129585246 | 98 |
| 225 | 3300005071 | Ga0068302_10021091 | Ga0068302_100210914 | 98 |
| 226 | 3300005071 | Ga0068302_10124391 | Ga0068302_101243912 | 98 |
| 227 | 3300005071 | Ga0068302_10187713 | Ga0068302_101877133 | 98 |
| 228 | 3300005083 | Ga0068305_10005585 | Ga0068305_100055856 | 98 |
| 229 | 3300005083 | Ga0068305_10166497 | Ga0068305_101664974 | 98 |
| 230 | 3300005083 | Ga0068305_10722628 | Ga0068305_107226282 | 98 |
| 231 | 3300009784 | Ga0123357_10000330 | Ga0123357_1000033017 | 98 |
| 232 | 3300009784 | Ga0123357_10439421 | Ga0123357_104394212 | 98 |
| 233 | 3300009826 | Ga0123355_10378043 | Ga0123355_103780432 | 98 |
| 234 | 3300010049 | Ga0123356_10896032 | Ga0123356_108960322 | 98 |
| 235 | 3300010049 | Ga0123356_11372463 | Ga0123356_113724632 | 98 |
| 236 | 3300010167 | Ga0123353_11651944 | Ga0123353_116519442 | 98 |
| 237 | 3300010882 | Ga0123354_10001124 | Ga0123354_1000112434 | 98 |
| 238 | 3300010882 | Ga0123354_10025847 | Ga0123354_1002584713 | 98 |
| 239 | 3300042593 | Ga0466691_212240 | Ga0466691_212240_5887_6183 | 98 |
| 240 | 3300042609 | Ga0466722_253703 | Ga0466722_253703_756_1052 | 98 |
| 241 | 3300042613 | Ga0466710_139034 | Ga0466710_139034_292_588 | 98 |
| 242 | 3300012829 | Ga0160467_100137 | Ga0160467_1001376 | 99 |
| 243 | 3300042596 | Ga0466696_007662 | Ga0466696_007662_1348_1647 | 99 |
| 244 | 3300042596 | Ga0466696_178778 | Ga0466696_178778_327_626 | 99 |
| 245 | 3300042605 | Ga0466716_397647 | Ga0466716_397647_1851_2159 | 102 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00276 | Ribosomal_L23 | Ribosomal protein L23 | 8 | 98 | 0.96 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.76 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.