Protein Family IF06403

Metagenome Isolate
125 Members
36 Samples
120 Scaffolds
451.25 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_381443|Ga0466716_381443_1205_2716
Length
503 aa
Sequence
MGSDFFFRAARQCRMQAGLPCAAGRTAGRDGGGVMNGMKNKGPGNADSGDPRLEQPAPAALYYKTILRLALPIGLQNLIGFAVNFADNIMVGRLGDLAIAGVFIGNQIHSMVMFITSGIGATLVILATQYWGKKDIRSIRSLTAISLWVSLGAGAVFTILTAVFPGFIAGLLSNKEDVILSSVPYLRFIGLSFVFFTVSQVLVASQRSVEKVRFGMNIALITLVFNVGLNYCLIFGRLGFPALGVQGAALATLISRILECIVAACYVFGIDKRIALRLRDLGKLDKFLCFSLLKYGAPVVAGDIVWAANSFAYTAIVGRFTADIIASFNIAGMMNTMVYIWMSGLAAALGIMTGKLVGGGAPVAAIKAHSYRTQRFFPLVGLATGLFVFFFKGVLISFYNISPEAALAAPQLLNVLALTIVGTAYQMPGLGGLVKAGGNISFVFRNDFIFVFFVVIPSSIIAMLLKAPAWVVFLCLKCDQILKCFVALVVINRFRWIKDLTRG

📊 Sample Types

Isolate 4.0%
Metagenome 96.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 38.9%
Termitidae 30.6%
Unclassified 13.9%
Rhinotermitidae 5.6%
Passalidae 5.6%
Termopsidae 5.6%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
9 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
10 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
11 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
12 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
13 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
14 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
19 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
20 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_062840 3300042612 Bacteria 11498
2 Ga0466705_093770 3300042612 Bacteria 7062
3 Ga0466705_521189 3300042612 Bacteria 9208
4 Ga0466715_148279 3300042616 Bacteria 16154
5 Ga0466715_269810 3300042616 Bacteria 39825
6 Ga0466723_169571 3300042618 Bacteria 27673
7 Ga0466723_232345 3300042618 Bacteria 8684
8 Ga0123356_10015129 3300010049 Bacteria 7399
9 Ga0123353_10006657 3300010167 Bacteria 15443
10 Ga0123353_10237551 3300010167 Bacteria 2835
11 Ga0466690_075308 3300042590 Bacteria 6287
12 Ga0466691_213540 3300042593 Bacteria 2959
13 Ga0466696_460146 3300042596 Bacteria 25654
14 Ga0466708_249108 3300042652 Bacteria 5923
15 Ga0466712_028857 3300042614 Bacteria 2069
16 Ga0466715_012720 3300042616 Bacteria 11389
17 Ga0466715_131374 3300042616 Bacteria 15464
18 Ga0466723_263933 3300042618 Bacteria 4882
19 Ga0466726_175894 3300042619 Bacteria 1504
20 Ga0466726_326088 3300042619 Bacteria 2055
21 Ga0466726_433148 3300042619 Bacteria 2980
22 Ga0123356_10000033 3300010049 Bacteria 152581
23 Ga0466696_223433 3300042596 Bacteria 1961
24 Ga0466696_471025 3300042596 Bacteria 11169
25 Ga0466703_205642 3300042636 Bacteria 23905
26 Ga0466708_226005 3300042652 Bacteria 2871
27 Ga0466727_333677 3300042655 Bacteria 1354
28 Ga0466719_103798 3300042606 Bacteria 10547
29 Ga0466721_281777 3300042608 Bacteria 11632
30 Ga0466722_152337 3300042609 Bacteria 12751
31 Ga0466712_197350 3300042614 Bacteria 26294
32 Ga0466715_356842 3300042616 Bacteria 1925
33 Ga0466728_008499 3300042620 Bacteria 3862
34 Ga0415639_004452 3300038395 Bacteria 2406
35 Ga0466691_103015 3300042593 Bacteria 4449
36 Ga0466696_312523 3300042596 Bacteria 4580
37 Ga0466702_376825 3300042635 Unclassified 2838
38 Ga0466703_308219 3300042636 Bacteria 16421
39 Ga0466704_262051 3300042643 Bacteria 4877
40 Ga0466709_322174 3300042648 Bacteria 2821
41 Ga0466708_176007 3300042652 Bacteria 3458
42 Ga0466719_191387 3300042606 Bacteria 2786
43 JGI24698J34947_10002139 3300002449 Bacteria 10581
44 Ga0466715_311690 3300042616 Bacteria 7893
45 Ga0466726_115044 3300042619 Bacteria 1546
46 Ga0123357_10269364 3300009784 Bacteria 1783
47 Ga0123356_10000028 3300010049 Bacteria 164875
48 Ga0123356_10056776 3300010049 Bacteria 3648
49 Ga0123356_10092050 3300010049 Unclassified 2891
50 Ga0466696_142716 3300042596 Bacteria 15106
51 Ga0466703_273540 3300042636 Bacteria 18168
52 Ga0466703_333038 3300042636 Bacteria 2528
53 Ga0466704_151402 3300042643 Bacteria 3493
54 Ga0466719_036149 3300042606 Bacteria 9087
55 Ga0466721_341014 3300042608 Bacteria 2870
56 Ga0466722_126821 3300042609 Bacteria 1901
57 Ga0466722_244561 3300042609 Bacteria 3164
58 Ga0466711_175339 3300042615 Bacteria 20337
59 Ga0466711_239098 3300042615 Bacteria 5865
60 Ga0466715_195197 3300042616 Bacteria 5049
61 Ga0466690_111986 3300042590 Bacteria 3098
62 Ga0466696_442695 3300042596 Bacteria 6430
63 Ga0466703_275780 3300042636 Bacteria 5623
64 Ga0466704_064229 3300042643 Bacteria 7871
65 Ga0466704_149454 3300042643 Bacteria 2104
66 Ga0466709_315407 3300042648 Bacteria 3428
67 Ga0466708_148286 3300042652 Bacteria 7562
68 Ga0466727_018297 3300042655 Bacteria 2457
69 Ga0466727_336564 3300042655 Bacteria 5029
70 2227655188 2225789004 Bacteria 10624
71 JGI24698J34947_10002096 3300002449 Bacteria 10663
72 Ga0466705_263550 3300042612 Bacteria 16833
73 Ga0466705_520468 3300042612 Bacteria 7983
74 Ga0466726_012091 3300042619 Bacteria 3606
75 Ga0466726_300535 3300042619 Bacteria 2743
76 Ga0466726_449292 3300042619 Bacteria 9398
77 Ga0466728_330545 3300042620 Bacteria 1735
78 Ga0123355_10229747 3300009826 Bacteria 2651
79 Ga0123353_10289103 3300010167 Bacteria 2511
80 Ga0466696_245965 3300042596 Bacteria 17616
81 Ga0466703_046284 3300042636 Bacteria 2942
82 Ga0466703_073029 3300042636 Bacteria 8625
83 Ga0466703_203386 3300042636 Bacteria 2180
84 Ga0466703_225867 3300042636 Bacteria 6243
85 Ga0466703_259242 3300042636 Bacteria 6759
86 Ga0466703_304616 3300042636 Bacteria 21418
87 Ga0466704_606958 3300042643 Bacteria 82552
88 Ga0466709_067001 3300042648 Bacteria 7292
89 Ga0466701_101855 3300042598 Bacteria 136142
90 Ga0466716_230901 3300042605 Bacteria 6751
91 Ga0466716_381443 3300042605 Bacteria 5985
92 Ga0466716_468531 3300042605 Bacteria 3706
93 IMNBL1DRAFT_c0000003 3300000062 Bacteria 275310
94 Ga0466705_206545 3300042612 Bacteria 3047
95 Ga0466705_506313 3300042612 Unclassified 4818
96 Ga0123356_10022412 3300010049 Bacteria 5964
97 Ga0466692_000687 3300042591 Bacteria 14267
98 Ga0466691_060605 3300042593 Bacteria 14254
99 Ga0466702_323410 3300042635 Bacteria 53168
100 Ga0466709_135424 3300042648 Bacteria 3829
101 Ga0466709_193882 3300042648 Bacteria 5793
102 Ga0466708_464475 3300042652 Bacteria 69222
103 Ga0466722_029429 3300042609 Bacteria 3091
104 Ga0466705_101894 3300042612 Bacteria 11632
105 Ga0466705_110649 3300042612 Unclassified 2004
106 Ga0466705_146538 3300042612 Bacteria 158344
107 Ga0466712_089040 3300042614 Bacteria 4550
108 Ga0466728_198151 3300042620 Bacteria 4775
109 Ga0123356_10016042 3300010049 Bacteria 7160
110 Ga0123356_10129752 3300010049 Unclassified 2467
111 Ga0466691_193262 3300042593 Bacteria 2423
112 Ga0466694_145587 3300042594 Bacteria 5739
113 Ga0466696_325304 3300042596 Bacteria 9476
114 Ga0466702_065319 3300042635 Bacteria 12834
115 Ga0466702_370910 3300042635 Bacteria 2130
116 Ga0466703_001989 3300042636 Bacteria 25288
117 Ga0466704_514806 3300042643 Unclassified 4718
118 Ga0466727_233039 3300042655 Bacteria 9959
119 Ga0466716_188061 3300042605 Bacteria 1574
120 Ga0466722_036523 3300042609 Bacteria 6447

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_333677 Ga0466727_333677_179_1342 387
2 3300042609 Ga0466722_126821 Ga0466722_126821_699_1877 392
3 3300042605 Ga0466716_188061 Ga0466716_188061_238_1479 413
4 3300042619 Ga0466726_175894 Ga0466726_175894_43_1287 414
5 3300042614 Ga0466712_028857 Ga0466712_028857_777_2027 416
6 3300010049 Ga0123356_10056776 Ga0123356_100567762 418
7 3300042609 Ga0466722_244561 Ga0466722_244561_988_2334 419
8 3300010049 Ga0123356_10092050 Ga0123356_100920502 423
9 3300042606 Ga0466719_191387 Ga0466719_191387_1222_2592 424
10 3300042609 Ga0466722_152337 Ga0466722_152337_11155_12435 426
11 3300042609 Ga0466722_036523 Ga0466722_036523_2223_3518 431
12 3300042635 Ga0466702_376825 Ga0466702_376825_472_1767 431
13 3300010167 Ga0123353_10289103 Ga0123353_102891032 432
14 3300042608 Ga0466721_281777 Ga0466721_281777_9664_11007 434
15 3300010049 Ga0123356_10022412 Ga0123356_100224124 435
16 3300042593 Ga0466691_060605 Ga0466691_060605_7327_8658 435
17 3300042608 Ga0466721_341014 Ga0466721_341014_1209_2552 435
18 3300042648 Ga0466709_193882 Ga0466709_193882_3661_5025 436
19 3300010167 Ga0123353_10237551 Ga0123353_102375513 437
20 3300042619 Ga0466726_012091 Ga0466726_012091_2231_3589 438
21 3300042619 Ga0466726_449292 Ga0466726_449292_1299_2615 438
22 3300010049 Ga0123356_10000033 Ga0123356_1000003352 439
23 3300010049 Ga0123356_10016042 Ga0123356_100160422 439
24 3300042612 Ga0466705_146538 Ga0466705_146538_136370_137689 439
25 3300009826 Ga0123355_10229747 Ga0123355_102297472 441
26 iso_pr_bacteria 2820570671 2820571712 443
27 3300009784 Ga0123357_10269364 Ga0123357_102693642 444
28 3300042614 Ga0466712_089040 Ga0466712_089040_1013_2347 444
29 3300042616 Ga0466715_356842 Ga0466715_356842_452_1792 446
30 3300042636 Ga0466703_304616 Ga0466703_304616_19340_20722 446
31 3300042648 Ga0466709_315407 Ga0466709_315407_334_1674 446
32 3300010049 Ga0123356_10129752 Ga0123356_101297522 447
33 3300010049 Ga0123356_10015129 Ga0123356_100151298 448
34 3300042596 Ga0466696_460146 Ga0466696_460146_16899_18245 448
35 3300042612 Ga0466705_101894 Ga0466705_101894_229_1575 448
36 3300042615 Ga0466711_175339 Ga0466711_175339_2380_3726 448
37 3300042619 Ga0466726_115044 Ga0466726_115044_119_1465 448
38 iso_pr_bacteria 2820566695 2820567026 448
39 3300042596 Ga0466696_223433 Ga0466696_223433_145_1494 449
40 3300042612 Ga0466705_110649 Ga0466705_110649_423_1775 450
41 3300042635 Ga0466702_323410 Ga0466702_323410_29956_31332 450
42 3300042643 Ga0466704_149454 Ga0466704_149454_395_1747 450
43 iso_pr_bacteria 2820267566 2820269000 450
44 2225789004 2227655188 2228253020 451
45 3300042593 Ga0466691_193262 Ga0466691_193262_100_1455 451
46 3300042596 Ga0466696_442695 Ga0466696_442695_3052_4407 451
47 3300042609 Ga0466722_029429 Ga0466722_029429_718_2073 451
48 3300042612 Ga0466705_093770 Ga0466705_093770_1875_3230 451
49 3300042636 Ga0466703_205642 Ga0466703_205642_11548_12903 451
50 3300042643 Ga0466704_606958 Ga0466704_606958_24165_25520 451
51 3300000062 IMNBL1DRAFT_c0000003 IMNBL1DRAFT_0000003127 452
52 3300042590 Ga0466690_111986 Ga0466690_111986_609_1967 452
53 3300042593 Ga0466691_213540 Ga0466691_213540_410_1768 452
54 3300042612 Ga0466705_263550 Ga0466705_263550_14965_16323 452
55 3300042636 Ga0466703_225867 Ga0466703_225867_3952_5334 452
56 3300042636 Ga0466703_333038 Ga0466703_333038_486_1877 452
57 3300042591 Ga0466692_000687 Ga0466692_000687_1995_3356 453
58 3300042606 Ga0466719_103798 Ga0466719_103798_4589_5950 453
59 3300042615 Ga0466711_239098 Ga0466711_239098_1080_2441 453
60 3300042616 Ga0466715_311690 Ga0466715_311690_5379_6740 453
61 3300042619 Ga0466726_433148 Ga0466726_433148_1606_2967 453
62 3300042636 Ga0466703_259242 Ga0466703_259242_3062_4423 453
63 3300042643 Ga0466704_262051 Ga0466704_262051_2762_4123 453
64 3300042596 Ga0466696_142716 Ga0466696_142716_12608_13972 454
65 3300042616 Ga0466715_131374 Ga0466715_131374_1425_2789 454
66 3300042616 Ga0466715_148279 Ga0466715_148279_171_1535 454
67 3300042635 Ga0466702_370910 Ga0466702_370910_493_1857 454
68 3300042636 Ga0466703_001989 Ga0466703_001989_16431_17795 454
69 3300042596 Ga0466696_312523 Ga0466696_312523_1097_2464 455
70 3300042619 Ga0466726_326088 Ga0466726_326088_568_1935 455
71 3300010049 Ga0123356_10000028 Ga0123356_10000028163 456
72 3300042590 Ga0466690_075308 Ga0466690_075308_659_2056 456
73 3300042594 Ga0466694_145587 Ga0466694_145587_384_1754 456
74 3300042605 Ga0466716_468531 Ga0466716_468531_1480_2850 456
75 3300042614 Ga0466712_197350 Ga0466712_197350_11610_12980 456
76 3300042636 Ga0466703_203386 Ga0466703_203386_666_2036 456
77 3300042636 Ga0466703_308219 Ga0466703_308219_1246_2643 456
78 3300002449 JGI24698J34947_10002096 JGI24698J34947_100020966 457
79 3300042598 Ga0466701_101855 Ga0466701_101855_77580_78953 457
80 3300042616 Ga0466715_269810 Ga0466715_269810_19290_20663 457
81 3300042636 Ga0466703_073029 Ga0466703_073029_705_2078 457
82 3300042655 Ga0466727_336564 Ga0466727_336564_1094_2467 457
83 3300042596 Ga0466696_245965 Ga0466696_245965_12756_14132 458
84 3300042620 Ga0466728_198151 Ga0466728_198151_1219_2595 458
85 3300042635 Ga0466702_065319 Ga0466702_065319_10182_11558 458
86 3300038395 Ga0415639_004452 Ga0415639_004452_750_2129 459
87 3300042593 Ga0466691_103015 Ga0466691_103015_1564_2943 459
88 3300042612 Ga0466705_206545 Ga0466705_206545_43_1422 459
89 3300042620 Ga0466728_330545 Ga0466728_330545_239_1618 459
90 3300042652 Ga0466708_148286 Ga0466708_148286_3133_4512 459
91 3300042652 Ga0466708_176007 Ga0466708_176007_253_1632 459
92 iso_pr_bacteria 2781125652 2781312209 459
93 3300042612 Ga0466705_062840 Ga0466705_062840_3657_5039 460
94 3300042652 Ga0466708_226005 Ga0466708_226005_274_1656 460
95 3300042655 Ga0466727_018297 Ga0466727_018297_317_1699 460
96 3300042596 Ga0466696_325304 Ga0466696_325304_7788_9173 461
97 3300042616 Ga0466715_195197 Ga0466715_195197_948_2333 461
98 3300042618 Ga0466723_232345 Ga0466723_232345_2413_3798 461
99 3300042618 Ga0466723_263933 Ga0466723_263933_1612_2997 461
100 3300042619 Ga0466726_300535 Ga0466726_300535_510_1895 461
101 3300042636 Ga0466703_046284 Ga0466703_046284_93_1478 461
102 3300042643 Ga0466704_064229 Ga0466704_064229_5253_6638 461
103 3300042648 Ga0466709_067001 Ga0466709_067001_3699_5084 461
104 3300042648 Ga0466709_135424 Ga0466709_135424_2300_3685 461
105 3300042648 Ga0466709_322174 Ga0466709_322174_1173_2558 461
106 3300042655 Ga0466727_233039 Ga0466727_233039_2601_3986 461
107 3300010167 Ga0123353_10006657 Ga0123353_1000665716 462
108 3300042620 Ga0466728_008499 Ga0466728_008499_24_1412 462
109 3300042612 Ga0466705_520468 Ga0466705_520468_1971_3362 463
110 3300042616 Ga0466715_012720 Ga0466715_012720_2279_3670 463
111 3300042636 Ga0466703_275780 Ga0466703_275780_2675_4066 463
112 3300042643 Ga0466704_151402 Ga0466704_151402_453_1844 463
113 3300042643 Ga0466704_514806 Ga0466704_514806_2638_4029 463
114 3300042652 Ga0466708_464475 Ga0466708_464475_33451_34842 463
115 3300042596 Ga0466696_471025 Ga0466696_471025_7687_9081 464
116 3300042605 Ga0466716_230901 Ga0466716_230901_1080_2474 464
117 3300042612 Ga0466705_521189 Ga0466705_521189_523_1917 464
118 3300042636 Ga0466703_273540 Ga0466703_273540_3468_4862 464
119 3300042652 Ga0466708_249108 Ga0466708_249108_3429_4823 464
120 3300042618 Ga0466723_169571 Ga0466723_169571_973_2370 465
121 3300042612 Ga0466705_506313 Ga0466705_506313_910_2310 466
122 3300042606 Ga0466719_036149 Ga0466719_036149_6307_7737 476
123 3300002449 JGI24698J34947_10002139 JGI24698J34947_100021393 501
124 3300042605 Ga0466716_381443 Ga0466716_381443_1205_2716 503
125 iso_pr_bacteria 650716099 650879697 513

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01554 MatE MatE 72 231 0.99
PF14667 Polysacc_synt_C Polysaccharide biosynthesis C-terminal domain 185 297 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.