Protein Family IF06391
Metagenome
Isolate
190
Members
64
Samples
160
Scaffolds
359.93
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_316339|Ga0466716_316339_1607_2935
- Length
- 442 aa
- Sequence
- MDYPDWKSKFYTVYGFMKIILPLRRKQLRFILKSLFDNVLVHTCLAELAIVRNRSQNHFFLFSLLTGRERVNTIATHFVNVFMKSFFIGNKEIKLPIIQGGMGVGISLSGLASAVANEGGIGVISCAGLGLLYRQTPGSYFQNCIWGLKEEMRNAREKTKGVVGLNIMVALSNFADMVRTAIAEKADIIFAGAGLPLDLPSYLTPDSKTLLVPIVSSARAAKIICEKWKNNYNYLPDMIVVEGPKAGGHLGFKKEQIDDSNYSLETLIPEVVAVASQYNSDKIIPVIAAGGITTGEDVLRFMELGAAGVQMGSIFVPTYECDAAIEFKQVYINSNQNDMMIIQSPVGMPGRAFDGEFIRSVNEGKETPKGCPFNCIKTCDYSKSPYCIIKALYNAARGNMKKGYAFAGANAYLAQKISSVKEVVANLKEEFAAAKQKMKLNR
Sample Types
Isolate
15.8%
Metagenome
84.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
29.7%
Termitidae
21.9%
Kalotermitidae
18.8%
Unclassified
10.9%
Termopsidae
6.2%
Rhinotermitidae
4.7%
Passalidae
3.1%
Hydrophilidae
3.1%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
176
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 2 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 3 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 4 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 5 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 6 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 7 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 8 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 9 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 10 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 15 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 16 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 21 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 27 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 28 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 29 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 32 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 33 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 34 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 35 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 36 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 37 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 38 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 44 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 45 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 50 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 51 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 56 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 57 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 58 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 61 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 62 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 63 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 64 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_478198 | 3300042612 | Unclassified | 35992 |
| 2 | Ga0466726_105886 | 3300042619 | Bacteria | 9690 |
| 3 | Ga0466726_338407 | 3300042619 | Bacteria | 3259 |
| 4 | Ga0466726_420136 | 3300042619 | Bacteria | 2103 |
| 5 | Ga0123357_10087568 | 3300009784 | Bacteria | 4073 |
| 6 | Ga0123353_10492387 | 3300010167 | Bacteria | 1789 |
| 7 | Ga0466703_268814 | 3300042636 | Unclassified | 6154 |
| 8 | Ga0466704_164583 | 3300042643 | Bacteria | 22294 |
| 9 | Ga0466704_283124 | 3300042643 | Bacteria | 7595 |
| 10 | Ga0466704_405361 | 3300042643 | Bacteria | 3758 |
| 11 | Ga0466725_248089 | 3300042654 | Bacteria | 18244 |
| 12 | Ga0466727_252649 | 3300042655 | Bacteria | 1710 |
| 13 | Ga0466713_000776 | 3300042602 | Bacteria | 6235 |
| 14 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 15 | Ga0466716_544654 | 3300042605 | Bacteria | 4283 |
| 16 | Ga0466690_037266 | 3300042590 | Bacteria | 13453 |
| 17 | Ga0466690_137824 | 3300042590 | Bacteria | 3980 |
| 18 | Ga0466690_205278 | 3300042590 | Bacteria | 19372 |
| 19 | Ga0466696_028155 | 3300042596 | Bacteria | 4190 |
| 20 | Ga0466696_173954 | 3300042596 | Bacteria | 14904 |
| 21 | Ga0466696_200357 | 3300042596 | Bacteria | 3027 |
| 22 | Ga0466696_383933 | 3300042596 | Bacteria | 13857 |
| 23 | IMNBL1DRAFT_c0005838 | 3300000062 | Bacteria | 6905 |
| 24 | IMNBL1DRAFT_c0029888 | 3300000062 | Bacteria | 2008 |
| 25 | Ga0466733_077483 | 3300042659 | Bacteria | 5522 |
| 26 | Ga0466710_088431 | 3300042613 | Unclassified | 4965 |
| 27 | Ga0466715_202340 | 3300042616 | Bacteria | 25238 |
| 28 | Ga0466729_046059 | 3300042621 | Bacteria | 6475 |
| 29 | Ga0466729_208291 | 3300042621 | Bacteria | 9574 |
| 30 | Ga0466731_195504 | 3300042622 | Bacteria | 2013 |
| 31 | Ga0466703_200016 | 3300042636 | Bacteria | 20395 |
| 32 | Ga0466703_287762 | 3300042636 | Bacteria | 2620 |
| 33 | Ga0466707_161945 | 3300042601 | Bacteria | 21911 |
| 34 | Ga0466714_012453 | 3300042603 | Bacteria | 3641 |
| 35 | Ga0466714_135156 | 3300042603 | Bacteria | 46237 |
| 36 | Ga0466716_220693 | 3300042605 | Unclassified | 2001 |
| 37 | Ga0466656_174250 | 3300042550 | Bacteria | 2151 |
| 38 | Ga0466690_172863 | 3300042590 | Bacteria | 2180 |
| 39 | Ga0466705_220129 | 3300042612 | Bacteria | 17831 |
| 40 | Ga0466733_033301 | 3300042659 | Bacteria | 13216 |
| 41 | Ga0466733_216416 | 3300042659 | Bacteria | 8956 |
| 42 | Ga0466711_032350 | 3300042615 | Bacteria | 1581 |
| 43 | Ga0466715_262391 | 3300042616 | Bacteria | 8919 |
| 44 | Ga0466726_210019 | 3300042619 | Bacteria | 2547 |
| 45 | Ga0466734_046064 | 3300042623 | Unclassified | 1585 |
| 46 | Ga0466730_087402 | 3300042625 | Bacteria | 3425 |
| 47 | Ga0466704_130934 | 3300042643 | Bacteria | 116573 |
| 48 | Ga0466704_162262 | 3300042643 | Unclassified | 4226 |
| 49 | Ga0466727_248183 | 3300042655 | Bacteria | 1280 |
| 50 | Ga0466706_113167 | 3300042599 | Bacteria | 48207 |
| 51 | Ga0466713_000083 | 3300042602 | Unclassified | 16677 |
| 52 | Ga0466713_045544 | 3300042602 | Bacteria | 37734 |
| 53 | Ga0466714_111320 | 3300042603 | Bacteria | 185233 |
| 54 | Ga0466716_089156 | 3300042605 | Bacteria | 20040 |
| 55 | Ga0466656_372431 | 3300042550 | Bacteria | 8865 |
| 56 | Ga0466690_165481 | 3300042590 | Bacteria | 5185 |
| 57 | Ga0466696_142283 | 3300042596 | Bacteria | 3326 |
| 58 | Ga0466696_347081 | 3300042596 | Bacteria | 14959 |
| 59 | 2227463258 | 2225789004 | Bacteria | 5327 |
| 60 | IMNBL1DRAFT_c0004268 | 3300000062 | Bacteria | 8653 |
| 61 | Ga0068305_10010571 | 3300005083 | Bacteria | 68461 |
| 62 | Ga0466697_062627 | 3300042611 | Bacteria | 1206 |
| 63 | Ga0466705_080087 | 3300042612 | Bacteria | 5563 |
| 64 | Ga0466733_030534 | 3300042659 | Bacteria | 73502 |
| 65 | Ga0466733_135899 | 3300042659 | Bacteria | 1559 |
| 66 | Ga0466711_195073 | 3300042615 | Bacteria | 48167 |
| 67 | Ga0466711_475590 | 3300042615 | Bacteria | 3966 |
| 68 | Ga0466729_312694 | 3300042621 | Bacteria | 19105 |
| 69 | Ga0466734_068923 | 3300042623 | Unclassified | 3005 |
| 70 | Ga0466735_233551 | 3300042624 | Bacteria | 4828 |
| 71 | Ga0466704_314375 | 3300042643 | Bacteria | 15355 |
| 72 | Ga0466704_504676 | 3300042643 | Bacteria | 1386 |
| 73 | Ga0466727_059739 | 3300042655 | Bacteria | 31829 |
| 74 | Ga0466727_291825 | 3300042655 | Bacteria | 5487 |
| 75 | Ga0466714_062584 | 3300042603 | Bacteria | 4617 |
| 76 | Ga0466716_157944 | 3300042605 | Bacteria | 2126 |
| 77 | Ga0466716_413309 | 3300042605 | Bacteria | 7186 |
| 78 | Ga0466716_453587 | 3300042605 | Bacteria | 5291 |
| 79 | Ga0466656_332180 | 3300042550 | Bacteria | 1662 |
| 80 | Ga0466696_016140 | 3300042596 | Bacteria | 10592 |
| 81 | IMNBL1DRAFT_c0000877 | 3300000062 | Bacteria | 23465 |
| 82 | IMNBL1DRAFT_c0001146 | 3300000062 | Unclassified | 20292 |
| 83 | Ga0068302_10401671 | 3300005071 | Bacteria | 1522 |
| 84 | Ga0466729_172133 | 3300042621 | Bacteria | 11824 |
| 85 | Ga0466703_170236 | 3300042636 | Bacteria | 10306 |
| 86 | Ga0466707_039407 | 3300042601 | Bacteria | 14808 |
| 87 | Ga0466707_211611 | 3300042601 | Bacteria | 2079 |
| 88 | Ga0466714_044700 | 3300042603 | Bacteria | 6114 |
| 89 | Ga0466714_077400 | 3300042603 | Bacteria | 5561 |
| 90 | Ga0466714_096362 | 3300042603 | Bacteria | 3791 |
| 91 | Ga0466716_478696 | 3300042605 | Bacteria | 2499 |
| 92 | Ga0466657_037636 | 3300042582 | Bacteria | 12689 |
| 93 | Ga0466657_356015 | 3300042582 | Bacteria | 3472 |
| 94 | Ga0466696_032958 | 3300042596 | Bacteria | 2628 |
| 95 | 2227509662 | 2225789004 | Bacteria | 3591 |
| 96 | IMNBL1DRAFT_c0002253 | 3300000062 | Bacteria | 13587 |
| 97 | IMNBL1DRAFT_c0007305 | 3300000062 | Bacteria | 5841 |
| 98 | IMNBL1DRAFT_c0021691 | 3300000062 | Bacteria | 2563 |
| 99 | IMNBL1DRAFT_c0032740 | 3300000062 | Bacteria | 1870 |
| 100 | Ga0466697_192761 | 3300042611 | Bacteria | 1741 |
| 101 | Ga0466705_099249 | 3300042612 | Bacteria | 16129 |
| 102 | Ga0466733_108090 | 3300042659 | Bacteria | 2942 |
| 103 | Ga0466733_125363 | 3300042659 | Unclassified | 2174 |
| 104 | Ga0466711_162013 | 3300042615 | Bacteria | 2517 |
| 105 | Ga0466715_069098 | 3300042616 | Bacteria | 26446 |
| 106 | Ga0466723_367087 | 3300042618 | Bacteria | 16308 |
| 107 | Ga0466726_281465 | 3300042619 | Bacteria | 1644 |
| 108 | Ga0123357_10187726 | 3300009784 | Bacteria | 2392 |
| 109 | Ga0466703_209762 | 3300042636 | Bacteria | 7996 |
| 110 | Ga0466704_281596 | 3300042643 | Unclassified | 12455 |
| 111 | Ga0466709_325940 | 3300042648 | Bacteria | 6173 |
| 112 | Ga0466727_175213 | 3300042655 | Bacteria | 6566 |
| 113 | Ga0466700_026773 | 3300042600 | Bacteria | 20029 |
| 114 | Ga0466700_064065 | 3300042600 | Bacteria | 4290 |
| 115 | Ga0466719_517556 | 3300042606 | Bacteria | 1205 |
| 116 | 2227591301 | 2225789004 | Unclassified | 12937 |
| 117 | Ga0466697_192990 | 3300042611 | Bacteria | 1502 |
| 118 | Ga0466705_159897 | 3300042612 | Bacteria | 11503 |
| 119 | Ga0466705_245146 | 3300042612 | Bacteria | 23831 |
| 120 | Ga0466733_031893 | 3300042659 | Bacteria | 2824 |
| 121 | Ga0466726_114451 | 3300042619 | Bacteria | 6794 |
| 122 | Ga0466734_004362 | 3300042623 | Bacteria | 3519 |
| 123 | Ga0466735_032959 | 3300042624 | Bacteria | 1395 |
| 124 | Ga0466703_207047 | 3300042636 | Bacteria | 1581 |
| 125 | Ga0466704_068640 | 3300042643 | Bacteria | 17093 |
| 126 | Ga0466704_149374 | 3300042643 | Bacteria | 3835 |
| 127 | Ga0466704_376237 | 3300042643 | Unclassified | 1568 |
| 128 | Ga0466704_419926 | 3300042643 | Bacteria | 34927 |
| 129 | Ga0466727_292603 | 3300042655 | Bacteria | 6529 |
| 130 | Ga0466714_032725 | 3300042603 | Bacteria | 4337 |
| 131 | Ga0466716_316339 | 3300042605 | Bacteria | 3772 |
| 132 | Ga0466719_288739 | 3300042606 | Bacteria | 11703 |
| 133 | Ga0466696_230688 | 3300042596 | Bacteria | 36968 |
| 134 | Ga0466696_255767 | 3300042596 | Bacteria | 3270 |
| 135 | 2227466313 | 2225789004 | Bacteria | 24329 |
| 136 | Ga0068302_10018375 | 3300005071 | Bacteria | 5259 |
| 137 | Ga0068302_10066478 | 3300005071 | Bacteria | 11256 |
| 138 | Ga0466705_014017 | 3300042612 | Bacteria | 3927 |
| 139 | Ga0466732_247323 | 3300042656 | Bacteria | 1910 |
| 140 | Ga0466733_012935 | 3300042659 | Bacteria | 50823 |
| 141 | Ga0466733_036819 | 3300042659 | Bacteria | 26430 |
| 142 | Ga0466733_063312 | 3300042659 | Unclassified | 3254 |
| 143 | Ga0466733_078370 | 3300042659 | Bacteria | 49592 |
| 144 | Ga0466723_071110 | 3300042618 | Bacteria | 3512 |
| 145 | Ga0466728_402944 | 3300042620 | Bacteria | 13008 |
| 146 | Ga0466703_020971 | 3300042636 | Bacteria | 4484 |
| 147 | Ga0466703_107250 | 3300042636 | Bacteria | 3370 |
| 148 | Ga0466703_214962 | 3300042636 | Bacteria | 12325 |
| 149 | Ga0466709_185781 | 3300042648 | Bacteria | 39628 |
| 150 | Ga0466727_208255 | 3300042655 | Bacteria | 3424 |
| 151 | Ga0466706_265664 | 3300042599 | Bacteria | 22114 |
| 152 | Ga0466700_407157 | 3300042600 | Bacteria | 3019 |
| 153 | Ga0466707_076022 | 3300042601 | Bacteria | 24005 |
| 154 | Ga0466716_127759 | 3300042605 | Bacteria | 2605 |
| 155 | Ga0466719_051142 | 3300042606 | Bacteria | 3423 |
| 156 | Ga0466657_278738 | 3300042582 | Bacteria | 1869 |
| 157 | Ga0466696_281921 | 3300042596 | Bacteria | 14088 |
| 158 | IMNBL1DRAFT_c0001092 | 3300000062 | Bacteria | 20800 |
| 159 | IMNBL1DRAFT_c0002861 | 3300000062 | Bacteria | 11574 |
| 160 | IMNBL1DRAFT_c0007009 | 3300000062 | Bacteria | 6019 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_10492387 | Ga0123353_104923872 | 339 |
| 2 | 3300042596 | Ga0466696_016140 | Ga0466696_016140_1059_2123 | 354 |
| 3 | 3300042605 | Ga0466716_413309 | Ga0466716_413309_4976_6040 | 354 |
| 4 | 3300042605 | Ga0466716_544654 | Ga0466716_544654_1222_2286 | 354 |
| 5 | 3300042659 | Ga0466733_033301 | Ga0466733_033301_769_1833 | 354 |
| 6 | iso_pr_bacteria | 2940195863 | 2940197523 | 354 |
| 7 | 3300005071 | Ga0068302_10066478 | Ga0068302_100664782 | 355 |
| 8 | 3300042550 | Ga0466656_174250 | Ga0466656_174250_390_1457 | 355 |
| 9 | 3300042582 | Ga0466657_356015 | Ga0466657_356015_976_2043 | 355 |
| 10 | 3300042590 | Ga0466690_205278 | Ga0466690_205278_4699_5766 | 355 |
| 11 | 3300042596 | Ga0466696_028155 | Ga0466696_028155_2040_3107 | 355 |
| 12 | 3300042596 | Ga0466696_142283 | Ga0466696_142283_2231_3298 | 355 |
| 13 | 3300042596 | Ga0466696_200357 | Ga0466696_200357_1253_2320 | 355 |
| 14 | 3300042596 | Ga0466696_281921 | Ga0466696_281921_12621_13688 | 355 |
| 15 | 3300042601 | Ga0466707_211611 | Ga0466707_211611_159_1226 | 355 |
| 16 | 3300042612 | Ga0466705_099249 | Ga0466705_099249_6497_7564 | 355 |
| 17 | 3300042612 | Ga0466705_159897 | Ga0466705_159897_5206_6273 | 355 |
| 18 | 3300042612 | Ga0466705_220129 | Ga0466705_220129_3621_4688 | 355 |
| 19 | 3300042615 | Ga0466711_162013 | Ga0466711_162013_994_2061 | 355 |
| 20 | 3300042616 | Ga0466715_069098 | Ga0466715_069098_724_1791 | 355 |
| 21 | 3300042620 | Ga0466728_402944 | Ga0466728_402944_11665_12732 | 355 |
| 22 | 3300042643 | Ga0466704_149374 | Ga0466704_149374_2331_3398 | 355 |
| 23 | 3300042643 | Ga0466704_162262 | Ga0466704_162262_2178_3245 | 355 |
| 24 | 3300042643 | Ga0466704_281596 | Ga0466704_281596_783_1850 | 355 |
| 25 | 3300042643 | Ga0466704_314375 | Ga0466704_314375_14031_15098 | 355 |
| 26 | 3300042643 | Ga0466704_376237 | Ga0466704_376237_36_1103 | 355 |
| 27 | 3300042643 | Ga0466704_504676 | Ga0466704_504676_284_1351 | 355 |
| 28 | 3300042655 | Ga0466727_248183 | Ga0466727_248183_104_1171 | 355 |
| 29 | 3300042655 | Ga0466727_292603 | Ga0466727_292603_4079_5146 | 355 |
| 30 | 3300042659 | Ga0466733_077483 | Ga0466733_077483_2670_3737 | 355 |
| 31 | 3300042659 | Ga0466733_078370 | Ga0466733_078370_1644_2711 | 355 |
| 32 | 3300042659 | Ga0466733_135899 | Ga0466733_135899_454_1521 | 355 |
| 33 | 2225789004 | 2227591301 | 2228151022 | 356 |
| 34 | 3300000062 | IMNBL1DRAFT_c0004268 | IMNBL1DRAFT_00042683 | 356 |
| 35 | 3300000062 | IMNBL1DRAFT_c0032740 | IMNBL1DRAFT_00327402 | 356 |
| 36 | 3300042550 | Ga0466656_372431 | Ga0466656_372431_715_1785 | 356 |
| 37 | 3300042590 | Ga0466690_037266 | Ga0466690_037266_630_1700 | 356 |
| 38 | 3300042606 | Ga0466719_288739 | Ga0466719_288739_1320_2390 | 356 |
| 39 | 3300042612 | Ga0466705_478198 | Ga0466705_478198_34375_35445 | 356 |
| 40 | 3300042615 | Ga0466711_032350 | Ga0466711_032350_434_1504 | 356 |
| 41 | 3300042618 | Ga0466723_071110 | Ga0466723_071110_1287_2357 | 356 |
| 42 | 3300042623 | Ga0466734_004362 | Ga0466734_004362_918_1988 | 356 |
| 43 | 3300042624 | Ga0466735_032959 | Ga0466735_032959_217_1287 | 356 |
| 44 | 3300042636 | Ga0466703_268814 | Ga0466703_268814_991_2061 | 356 |
| 45 | 3300042643 | Ga0466704_068640 | Ga0466704_068640_7332_8402 | 356 |
| 46 | 3300042648 | Ga0466709_325940 | Ga0466709_325940_217_1287 | 356 |
| 47 | iso_pr_bacteria | 2910930387 | 2910930418 | 356 |
| 48 | iso_pr_bacteria | 2910930387 | 2910930489 | 356 |
| 49 | iso_pr_bacteria | 2940199050 | 2940201888 | 356 |
| 50 | iso_pr_bacteria | 2940205530 | 2940206648 | 356 |
| 51 | iso_pr_bacteria | 2940209341 | 2940211242 | 356 |
| 52 | iso_pr_bacteria | 2940212447 | 2940213651 | 356 |
| 53 | iso_pr_bacteria | 2940298504 | 2940299705 | 356 |
| 54 | iso_pr_bacteria | 2940302308 | 2940303424 | 356 |
| 55 | iso_pr_bacteria | 2940306115 | 2940307444 | 356 |
| 56 | iso_pr_bacteria | 2940309933 | 2940310978 | 356 |
| 57 | iso_pr_bacteria | 2940313741 | 2940314878 | 356 |
| 58 | iso_pr_bacteria | 2940317558 | 2940318693 | 356 |
| 59 | iso_pr_bacteria | 2940321370 | 2940322416 | 356 |
| 60 | iso_pr_bacteria | 2940325180 | 2940326384 | 356 |
| 61 | iso_pr_bacteria | 2940328985 | 2940330190 | 356 |
| 62 | iso_pr_bacteria | 2940332795 | 2940333842 | 356 |
| 63 | iso_pr_bacteria | 2940346213 | 2940348934 | 356 |
| 64 | 3300000062 | IMNBL1DRAFT_c0002253 | IMNBL1DRAFT_000225310 | 357 |
| 65 | 3300000062 | IMNBL1DRAFT_c0007305 | IMNBL1DRAFT_00073053 | 357 |
| 66 | 3300042590 | Ga0466690_137824 | Ga0466690_137824_1527_2600 | 357 |
| 67 | 3300042596 | Ga0466696_173954 | Ga0466696_173954_2811_3884 | 357 |
| 68 | 3300042599 | Ga0466706_265664 | Ga0466706_265664_10437_11510 | 357 |
| 69 | 3300042603 | Ga0466714_062584 | Ga0466714_062584_2376_3449 | 357 |
| 70 | 3300042603 | Ga0466714_111320 | Ga0466714_111320_124983_126056 | 357 |
| 71 | 3300042611 | Ga0466697_062627 | Ga0466697_062627_28_1101 | 357 |
| 72 | 3300042612 | Ga0466705_080087 | Ga0466705_080087_1495_2568 | 357 |
| 73 | 3300042621 | Ga0466729_172133 | Ga0466729_172133_3794_4867 | 357 |
| 74 | 3300042621 | Ga0466729_208291 | Ga0466729_208291_995_2068 | 357 |
| 75 | 3300042623 | Ga0466734_046064 | Ga0466734_046064_84_1157 | 357 |
| 76 | 3300042623 | Ga0466734_068923 | Ga0466734_068923_929_2002 | 357 |
| 77 | 3300042643 | Ga0466704_130934 | Ga0466704_130934_44952_46025 | 357 |
| 78 | 3300042655 | Ga0466727_252649 | Ga0466727_252649_587_1660 | 357 |
| 79 | 3300042655 | Ga0466727_291825 | Ga0466727_291825_3410_4483 | 357 |
| 80 | iso_pr_bacteria | 2695420317 | 2695486021 | 357 |
| 81 | iso_pr_bacteria | 2873600114 | 2873602436 | 357 |
| 82 | iso_pr_bacteria | 2873610414 | 2873612787 | 357 |
| 83 | iso_pr_bacteria | 8100157865 | 8100157974 | 357 |
| 84 | 2225789004 | 2227463258 | 2227898178 | 358 |
| 85 | 3300000062 | IMNBL1DRAFT_c0000877 | IMNBL1DRAFT_000087710 | 358 |
| 86 | 3300000062 | IMNBL1DRAFT_c0002861 | IMNBL1DRAFT_00028614 | 358 |
| 87 | 3300000062 | IMNBL1DRAFT_c0021691 | IMNBL1DRAFT_00216912 | 358 |
| 88 | 3300000062 | IMNBL1DRAFT_c0029888 | IMNBL1DRAFT_00298882 | 358 |
| 89 | 3300042596 | Ga0466696_255767 | Ga0466696_255767_469_1545 | 358 |
| 90 | 3300042601 | Ga0466707_076022 | Ga0466707_076022_12628_13704 | 358 |
| 91 | 3300042602 | Ga0466713_045544 | Ga0466713_045544_12643_13719 | 358 |
| 92 | 3300042602 | Ga0466713_100528 | Ga0466713_100528_207009_208085 | 358 |
| 93 | 3300042603 | Ga0466714_032725 | Ga0466714_032725_3144_4220 | 358 |
| 94 | 3300042603 | Ga0466714_077400 | Ga0466714_077400_2344_3420 | 358 |
| 95 | 3300042603 | Ga0466714_096362 | Ga0466714_096362_179_1255 | 358 |
| 96 | 3300042603 | Ga0466714_135156 | Ga0466714_135156_16028_17104 | 358 |
| 97 | 3300042615 | Ga0466711_195073 | Ga0466711_195073_41394_42470 | 358 |
| 98 | 3300042619 | Ga0466726_420136 | Ga0466726_420136_909_1985 | 358 |
| 99 | 3300042625 | Ga0466730_087402 | Ga0466730_087402_1186_2262 | 358 |
| 100 | 3300042636 | Ga0466703_200016 | Ga0466703_200016_11244_12320 | 358 |
| 101 | 3300042636 | Ga0466703_209762 | Ga0466703_209762_5892_6968 | 358 |
| 102 | 3300042636 | Ga0466703_287762 | Ga0466703_287762_1380_2456 | 358 |
| 103 | 3300042643 | Ga0466704_419926 | Ga0466704_419926_31539_32615 | 358 |
| 104 | 3300042659 | Ga0466733_036819 | Ga0466733_036819_4691_5767 | 358 |
| 105 | 3300042659 | Ga0466733_063312 | Ga0466733_063312_544_1620 | 358 |
| 106 | 3300042659 | Ga0466733_125363 | Ga0466733_125363_825_1901 | 358 |
| 107 | iso_pr_bacteria | 2940193328 | 2940194862 | 358 |
| 108 | iso_pr_bacteria | 3004672520 | 3004672875 | 358 |
| 109 | 3300042582 | Ga0466657_037636 | Ga0466657_037636_11085_12164 | 359 |
| 110 | 3300042596 | Ga0466696_230688 | Ga0466696_230688_23366_24445 | 359 |
| 111 | 3300042600 | Ga0466700_026773 | Ga0466700_026773_1119_2198 | 359 |
| 112 | 3300042601 | Ga0466707_039407 | Ga0466707_039407_4748_5827 | 359 |
| 113 | 3300042601 | Ga0466707_161945 | Ga0466707_161945_19981_21060 | 359 |
| 114 | 3300042605 | Ga0466716_127759 | Ga0466716_127759_410_1489 | 359 |
| 115 | 3300042613 | Ga0466710_088431 | Ga0466710_088431_2754_3833 | 359 |
| 116 | 3300042622 | Ga0466731_195504 | Ga0466731_195504_698_1777 | 359 |
| 117 | 3300042636 | Ga0466703_214962 | Ga0466703_214962_10319_11398 | 359 |
| 118 | 3300042659 | Ga0466733_031893 | Ga0466733_031893_245_1324 | 359 |
| 119 | 2225789004 | 2227466313 | 2227905904 | 360 |
| 120 | 3300009784 | Ga0123357_10087568 | Ga0123357_100875684 | 360 |
| 121 | 3300009784 | Ga0123357_10187726 | Ga0123357_101877262 | 360 |
| 122 | 3300042582 | Ga0466657_278738 | Ga0466657_278738_711_1793 | 360 |
| 123 | 3300042600 | Ga0466700_407157 | Ga0466700_407157_1384_2466 | 360 |
| 124 | 3300042605 | Ga0466716_220693 | Ga0466716_220693_549_1631 | 360 |
| 125 | 3300042619 | Ga0466726_105886 | Ga0466726_105886_4240_5322 | 360 |
| 126 | 3300042619 | Ga0466726_114451 | Ga0466726_114451_2149_3231 | 360 |
| 127 | 3300042619 | Ga0466726_338407 | Ga0466726_338407_2164_3246 | 360 |
| 128 | 3300042655 | Ga0466727_059739 | Ga0466727_059739_14082_15164 | 360 |
| 129 | 3300042655 | Ga0466727_175213 | Ga0466727_175213_312_1394 | 360 |
| 130 | 3300042655 | Ga0466727_208255 | Ga0466727_208255_438_1520 | 360 |
| 131 | 3300042659 | Ga0466733_012935 | Ga0466733_012935_42729_43811 | 360 |
| 132 | 3300042659 | Ga0466733_030534 | Ga0466733_030534_18099_19181 | 360 |
| 133 | 3300000062 | IMNBL1DRAFT_c0001092 | IMNBL1DRAFT_00010927 | 361 |
| 134 | 3300000062 | IMNBL1DRAFT_c0001146 | IMNBL1DRAFT_00011469 | 361 |
| 135 | 3300000062 | IMNBL1DRAFT_c0005838 | IMNBL1DRAFT_00058386 | 361 |
| 136 | 3300000062 | IMNBL1DRAFT_c0007009 | IMNBL1DRAFT_00070094 | 361 |
| 137 | 3300005071 | Ga0068302_10401671 | Ga0068302_104016712 | 361 |
| 138 | 3300042605 | Ga0466716_089156 | Ga0466716_089156_17650_18735 | 361 |
| 139 | 3300042606 | Ga0466719_051142 | Ga0466719_051142_218_1303 | 361 |
| 140 | 3300042606 | Ga0466719_517556 | Ga0466719_517556_79_1164 | 361 |
| 141 | 3300042611 | Ga0466697_192990 | Ga0466697_192990_231_1316 | 361 |
| 142 | 3300042612 | Ga0466705_014017 | Ga0466705_014017_2255_3340 | 361 |
| 143 | 3300042612 | Ga0466705_245146 | Ga0466705_245146_14147_15232 | 361 |
| 144 | 3300042618 | Ga0466723_367087 | Ga0466723_367087_1097_2182 | 361 |
| 145 | 3300042621 | Ga0466729_046059 | Ga0466729_046059_1784_2869 | 361 |
| 146 | 3300042643 | Ga0466704_164583 | Ga0466704_164583_18970_20055 | 361 |
| 147 | 3300042643 | Ga0466704_283124 | Ga0466704_283124_6172_7257 | 361 |
| 148 | 3300042643 | Ga0466704_405361 | Ga0466704_405361_2452_3537 | 361 |
| 149 | iso_pr_bacteria | 2820789850 | 2820790543 | 361 |
| 150 | 3300005083 | Ga0068305_10010571 | Ga0068305_1001057113 | 362 |
| 151 | 3300042590 | Ga0466690_165481 | Ga0466690_165481_3435_4523 | 362 |
| 152 | 3300042596 | Ga0466696_032958 | Ga0466696_032958_453_1541 | 362 |
| 153 | 3300042596 | Ga0466696_347081 | Ga0466696_347081_8046_9134 | 362 |
| 154 | 3300042596 | Ga0466696_383933 | Ga0466696_383933_10742_11830 | 362 |
| 155 | 3300042600 | Ga0466700_064065 | Ga0466700_064065_1547_2635 | 362 |
| 156 | 3300042603 | Ga0466714_012453 | Ga0466714_012453_423_1511 | 362 |
| 157 | 3300042603 | Ga0466714_044700 | Ga0466714_044700_1384_2472 | 362 |
| 158 | 3300042605 | Ga0466716_157944 | Ga0466716_157944_597_1685 | 362 |
| 159 | 3300042616 | Ga0466715_202340 | Ga0466715_202340_9804_10892 | 362 |
| 160 | 3300042619 | Ga0466726_281465 | Ga0466726_281465_73_1161 | 362 |
| 161 | 2225789004 | 2227509662 | 2228002597 | 363 |
| 162 | 3300042599 | Ga0466706_113167 | Ga0466706_113167_138_1229 | 363 |
| 163 | 3300042636 | Ga0466703_107250 | Ga0466703_107250_201_1292 | 363 |
| 164 | 3300042602 | Ga0466713_000083 | Ga0466713_000083_15426_16520 | 364 |
| 165 | 3300042615 | Ga0466711_475590 | Ga0466711_475590_904_1998 | 364 |
| 166 | 3300042616 | Ga0466715_262391 | Ga0466715_262391_1962_3056 | 364 |
| 167 | 3300042619 | Ga0466726_210019 | Ga0466726_210019_1417_2529 | 364 |
| 168 | 3300042636 | Ga0466703_207047 | Ga0466703_207047_467_1561 | 364 |
| 169 | iso_pr_bacteria | 2695420314 | 2695473051 | 364 |
| 170 | iso_pr_bacteria | 2695420931 | 2698109498 | 364 |
| 171 | iso_pr_bacteria | 8100166142 | 8100169341 | 364 |
| 172 | iso_pr_bacteria | 8100166142 | 8100171077 | 364 |
| 173 | 3300005071 | Ga0068302_10018375 | Ga0068302_100183755 | 365 |
| 174 | 3300042602 | Ga0466713_000776 | Ga0466713_000776_158_1255 | 365 |
| 175 | 3300042605 | Ga0466716_453587 | Ga0466716_453587_3381_4478 | 365 |
| 176 | 3300042636 | Ga0466703_170236 | Ga0466703_170236_6612_7709 | 365 |
| 177 | 3300042648 | Ga0466709_185781 | Ga0466709_185781_10679_11776 | 365 |
| 178 | 3300042656 | Ga0466732_247323 | Ga0466732_247323_725_1822 | 365 |
| 179 | iso_pr_bacteria | 8100166142 | 8100170949 | 365 |
| 180 | 3300042605 | Ga0466716_478696 | Ga0466716_478696_1058_2158 | 366 |
| 181 | 3300042659 | Ga0466733_108090 | Ga0466733_108090_1667_2770 | 367 |
| 182 | 3300042659 | Ga0466733_216416 | Ga0466733_216416_2959_4062 | 367 |
| 183 | 3300042624 | Ga0466735_233551 | Ga0466735_233551_1281_2387 | 368 |
| 184 | 3300042621 | Ga0466729_312694 | Ga0466729_312694_17103_18215 | 370 |
| 185 | 3300042590 | Ga0466690_172863 | Ga0466690_172863_251_1372 | 373 |
| 186 | 3300042550 | Ga0466656_332180 | Ga0466656_332180_161_1288 | 375 |
| 187 | 3300042654 | Ga0466725_248089 | Ga0466725_248089_6870_8015 | 381 |
| 188 | 3300042611 | Ga0466697_192761 | Ga0466697_192761_22_1185 | 387 |
| 189 | 3300042605 | Ga0466716_316339 | Ga0466716_316339_1607_2935 | 442 |
| 190 | 3300042636 | Ga0466703_020971 | Ga0466703_020971_2251_3621 | 456 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00478 | GO:0003824 | catalytic activity | MF |
| PF03060 | GO:0018580 | nitronate monooxygenase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.8 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.