Protein Family IF06376

Metagenome Isolate
127 Members
40 Samples
124 Scaffolds
396.05 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_246645|Ga0466716_246645_945_2132
Length
384 aa
Sequence
MTLLQEKLAKYDAPQKAMAAGIYPYGRMIESDQDTEVQINGKKVLMFGSNAYLGLLNHPKVKEAAIEATRKYGTGCAGSRHLNGTLDIHITLEERLAKLVGKEEVMLYSTGFQVNLGVVSCLTGREDYIIWDELDHASIIEGHRLSYSNKLKYKHNDMDSLEKQLQKCEPDKVKLIVTDGVFSMEGDIANLPEIIALSKKYNASVMVDEAHGIGVLGKNGRGTCDHFGVSQDVDLIMGTFSKSLASIGGFIASNKATINFLRHHSRSYIFSASSTDIMLSEPERIERLWEHTHYALAGFRNMGCEIGHTSTPIIPLYIRDNDLTFLIVRELFDAGVFVNPVVSPXXXPTDTLIRFSLMATHRRDQLDFALDTIRKVFKSHGLIP

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.9%
Termitidae 30.8%
Termopsidae 7.7%
Unclassified 7.7%
Blattidae 7.7%
Passalidae 5.1%
Rhinotermitidae 2.6%
Hodotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
4 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
5 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
6 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
7 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
8 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
9 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
10 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
11 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
12 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
13 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 3004677695 Bacteroides sp. 214 Isolate Blattidae
17 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 2923982719 Parabacteroides sp. 52 Isolate Blattidae
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_531286 3300042612 Unclassified 9647
2 Ga0466728_180629 3300042620 Unclassified 3804
3 Ga0466728_391319 3300042620 Bacteria 47879
4 Ga0466728_429465 3300042620 Unclassified 1340
5 Ga0466716_026041 3300042605 Bacteria 4791
6 Ga0466716_240023 3300042605 Unclassified 23065
7 JGI24702J35022_10009284 3300002462 Bacteria 5529
8 Ga0466690_067439 3300042590 Unclassified 4655
9 Ga0466696_078047 3300042596 Bacteria 9525
10 Ga0466727_144223 3300042655 Bacteria 7333
11 Ga0466723_045946 3300042618 Bacteria 14034
12 Ga0466723_059094 3300042618 Bacteria 10996
13 Ga0466726_017447 3300042619 Bacteria 18731
14 Ga0466728_346068 3300042620 Bacteria 16431
15 Ga0466716_033411 3300042605 Bacteria 4581
16 Ga0466716_491029 3300042605 Bacteria 12634
17 Ga0466719_384150 3300042606 Bacteria 10216
18 2227133293 2225789004 Bacteria 1651
19 Ga0466690_104331 3300042590 Bacteria 9219
20 Ga0466696_194149 3300042596 Bacteria 4084
21 Ga0466703_038519 3300042636 Bacteria 3516
22 Ga0466703_057244 3300042636 Bacteria 4953
23 Ga0466708_148146 3300042652 Unclassified 13635
24 Ga0466708_315337 3300042652 Bacteria 30097
25 Ga0466725_323508 3300042654 Bacteria 8936
26 Ga0466727_022788 3300042655 Unclassified 3157
27 Ga0466697_164770 3300042611 Bacteria 2780
28 Ga0466732_346130 3300042656 Bacteria 4079
29 Ga0466711_209403 3300042615 Bacteria 19898
30 Ga0466715_099718 3300042616 Bacteria 10296
31 Ga0466723_245046 3300042618 Bacteria 23052
32 Ga0466723_350295 3300042618 Bacteria 15700
33 Ga0466726_063392 3300042619 Bacteria 8200
34 Ga0466728_070459 3300042620 Bacteria 23231
35 IMNBL1DRAFT_c0004041 3300000062 Bacteria 9008
36 JGI24696J40584_12959080 3300002834 Bacteria 4692
37 Ga0466735_085760 3300042624 Bacteria 9086
38 Ga0466703_273105 3300042636 Bacteria 5973
39 Ga0466704_236011 3300042643 Bacteria 6480
40 Ga0466704_387978 3300042643 Bacteria 7269
41 Ga0466704_489449 3300042643 Bacteria 27379
42 Ga0466708_368256 3300042652 Bacteria 26611
43 Ga0466723_033742 3300042618 Bacteria 108590
44 Ga0466723_302508 3300042618 Bacteria 10452
45 Ga0466728_391606 3300042620 Unclassified 3843
46 Ga0466713_011826 3300042602 Bacteria 13991
47 Ga0466719_527569 3300042606 Bacteria 15709
48 Ga0068305_10019648 3300005083 Bacteria 14289
49 Ga0072941_1031114 3300005201 Bacteria 13980
50 Ga0466691_107231 3300042593 Bacteria 26006
51 Ga0466696_174136 3300042596 Bacteria 71806
52 Ga0466696_224495 3300042596 Bacteria 11326
53 Ga0466735_172040 3300042624 Bacteria 3057
54 Ga0466703_013190 3300042636 Bacteria 16034
55 Ga0466704_197886 3300042643 Bacteria 18809
56 Ga0466709_023059 3300042648 Bacteria 19266
57 Ga0466709_248151 3300042648 Bacteria 4613
58 Ga0466708_056525 3300042652 Bacteria 81892
59 Ga0466727_123803 3300042655 Bacteria 15231
60 Ga0466727_224853 3300042655 Bacteria 23233
61 Ga0466711_331356 3300042615 Bacteria 8825
62 Ga0466728_042245 3300042620 Bacteria 5646
63 Ga0123353_10095078 3300010167 Bacteria 4801
64 Ga0466706_200638 3300042599 Bacteria 9777
65 Ga0466707_173054 3300042601 Bacteria 4675
66 Ga0466707_224365 3300042601 Bacteria 6777
67 Ga0466707_421782 3300042601 Bacteria 1315
68 Ga0466713_044512 3300042602 Bacteria 3094
69 Ga0466713_155470 3300042602 Bacteria 25745
70 Ga0466719_288509 3300042606 Bacteria 4632
71 JGI24702J35022_10047728 3300002462 Bacteria 2279
72 JGI24705J35276_12238730 3300002504 Bacteria 46742
73 Ga0466691_051170 3300042593 Bacteria 30156
74 Ga0466703_188996 3300042636 Unclassified 8613
75 Ga0466705_136466 3300042612 Bacteria 4510
76 Ga0466733_056566 3300042659 Bacteria 66737
77 Ga0466711_066442 3300042615 Bacteria 1303
78 Ga0466723_248818 3300042618 Bacteria 12301
79 Ga0466726_422663 3300042619 Bacteria 2393
80 Ga0466726_489858 3300042619 Bacteria 14478
81 Ga0466728_084203 3300042620 Bacteria 16395
82 Ga0466700_146839 3300042600 Unclassified 3891
83 Ga0466719_344505 3300042606 Bacteria 3883
84 2227302996 2225789004 Bacteria 29771
85 JGI24702J35022_10001361 3300002462 Bacteria 15177
86 JGI24702J35022_10013861 3300002462 Bacteria 4456
87 Ga0068305_10014842 3300005083 Bacteria 10698
88 Ga0466690_276263 3300042590 Bacteria 7139
89 Ga0466696_394022 3300042596 Bacteria 212291
90 Ga0466735_085063 3300042624 Bacteria 13418
91 Ga0466703_005286 3300042636 Bacteria 6777
92 Ga0466703_419148 3300042636 Bacteria 10322
93 Ga0466704_049568 3300042643 Bacteria 6330
94 Ga0466709_014287 3300042648 Bacteria 6407
95 Ga0466708_210902 3300042652 Bacteria 8044
96 Ga0466705_156841 3300042612 Bacteria 2728
97 Ga0466733_001791 3300042659 Bacteria 4067
98 Ga0466705_464125 3300042612 Unclassified 5582
99 Ga0466711_284098 3300042615 Bacteria 9669
100 Ga0466728_126600 3300042620 Bacteria 8698
101 Ga0123356_10070149 3300010049 Bacteria 3286
102 Ga0466716_094368 3300042605 Bacteria 6876
103 Ga0466722_201664 3300042609 Bacteria 6207
104 JGI24702J35022_10123888 3300002462 Bacteria 1429
105 Ga0466690_138338 3300042590 Unclassified 4388
106 Ga0466691_012156 3300042593 Bacteria 8598
107 Ga0466691_122940 3300042593 Bacteria 29128
108 Ga0466696_259711 3300042596 Bacteria 25289
109 Ga0466696_329395 3300042596 Bacteria 5595
110 Ga0466696_378352 3300042596 Bacteria 4616
111 Ga0466727_287526 3300042655 Bacteria 4040
112 Ga0466711_099472 3300042615 Bacteria 4205
113 Ga0466711_271146 3300042615 Bacteria 6417
114 Ga0466715_328233 3300042616 Bacteria 6858
115 Ga0466715_601997 3300042616 Bacteria 1849
116 Ga0466723_003602 3300042618 Bacteria 21190
117 Ga0466728_029447 3300042620 Unclassified 8851
118 Ga0466728_157644 3300042620 Bacteria 10630
119 Ga0466716_246645 3300042605 Bacteria 4114
120 Ga0466722_064987 3300042609 Bacteria 5448
121 Ga0466698_342604 3300042610 Bacteria 1726
122 Ga0466731_231417 3300042622 Bacteria 2285
123 Ga0466709_173366 3300042648 Bacteria 10922
124 Ga0466727_286513 3300042655 Bacteria 1204

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_429465 Ga0466728_429465_216_1289 357
2 3300005083 Ga0068305_10014842 Ga0068305_1001484211 372
3 3300042619 Ga0466726_489858 Ga0466726_489858_9256_10455 373
4 3300042620 Ga0466728_042245 Ga0466728_042245_58_1179 373
5 3300042620 Ga0466728_391606 Ga0466728_391606_1968_3089 373
6 3300042620 Ga0466728_346068 Ga0466728_346068_958_2094 378
7 3300042605 Ga0466716_246645 Ga0466716_246645_945_2132 384
8 3300042655 Ga0466727_287526 Ga0466727_287526_1041_2201 386
9 3300042600 Ga0466700_146839 Ga0466700_146839_2489_3691 389
10 3300042655 Ga0466727_286513 Ga0466727_286513_23_1192 389
11 3300042593 Ga0466691_122940 Ga0466691_122940_1043_2230 390
12 3300042605 Ga0466716_240023 Ga0466716_240023_15431_16618 390
13 3300042615 Ga0466711_099472 Ga0466711_099472_303_1478 391
14 3300042620 Ga0466728_084203 Ga0466728_084203_9321_10499 392
15 3300042643 Ga0466704_049568 Ga0466704_049568_3651_4829 392
16 3300005201 Ga0072941_1031114 Ga0072941_10311149 393
17 3300042590 Ga0466690_104331 Ga0466690_104331_6304_7488 394
18 3300042596 Ga0466696_078047 Ga0466696_078047_1954_3138 394
19 3300042596 Ga0466696_329395 Ga0466696_329395_2481_3665 394
20 3300042596 Ga0466696_378352 Ga0466696_378352_2873_4057 394
21 3300042601 Ga0466707_224365 Ga0466707_224365_2827_4011 394
22 3300042605 Ga0466716_491029 Ga0466716_491029_3998_5182 394
23 3300042606 Ga0466719_384150 Ga0466719_384150_5854_7038 394
24 3300042606 Ga0466719_527569 Ga0466719_527569_9121_10305 394
25 3300042609 Ga0466722_064987 Ga0466722_064987_3721_4905 394
26 3300042609 Ga0466722_201664 Ga0466722_201664_3088_4272 394
27 3300042612 Ga0466705_531286 Ga0466705_531286_3791_4975 394
28 3300042615 Ga0466711_209403 Ga0466711_209403_761_1945 394
29 3300042616 Ga0466715_328233 Ga0466715_328233_1449_2633 394
30 3300042616 Ga0466715_601997 Ga0466715_601997_588_1772 394
31 3300042618 Ga0466723_003602 Ga0466723_003602_5790_6974 394
32 3300042618 Ga0466723_033742 Ga0466723_033742_96500_97684 394
33 3300042618 Ga0466723_248818 Ga0466723_248818_828_2012 394
34 3300042620 Ga0466728_070459 Ga0466728_070459_13846_15030 394
35 3300042620 Ga0466728_157644 Ga0466728_157644_6068_7252 394
36 3300042620 Ga0466728_180629 Ga0466728_180629_1008_2192 394
37 3300042624 Ga0466735_085063 Ga0466735_085063_521_1705 394
38 3300042624 Ga0466735_172040 Ga0466735_172040_1300_2484 394
39 3300042636 Ga0466703_005286 Ga0466703_005286_2416_3600 394
40 3300042636 Ga0466703_038519 Ga0466703_038519_416_1600 394
41 3300042643 Ga0466704_197886 Ga0466704_197886_10927_12111 394
42 3300042643 Ga0466704_236011 Ga0466704_236011_2247_3431 394
43 3300042643 Ga0466704_387978 Ga0466704_387978_4250_5434 394
44 3300042643 Ga0466704_489449 Ga0466704_489449_10617_11801 394
45 3300042648 Ga0466709_173366 Ga0466709_173366_4431_5615 394
46 3300042648 Ga0466709_248151 Ga0466709_248151_1054_2238 394
47 3300042654 Ga0466725_323508 Ga0466725_323508_1805_2989 394
48 3300042655 Ga0466727_123803 Ga0466727_123803_680_1864 394
49 iso_pr_bacteria 3004677695 3004678335 394
50 2225789004 2227133293 2227531163 395
51 2225789004 2227302996 2227752805 395
52 3300002462 JGI24702J35022_10013861 JGI24702J35022_100138612 395
53 3300002462 JGI24702J35022_10047728 JGI24702J35022_100477281 395
54 3300042590 Ga0466690_067439 Ga0466690_067439_2721_3908 395
55 3300042593 Ga0466691_051170 Ga0466691_051170_10955_12142 395
56 3300042593 Ga0466691_107231 Ga0466691_107231_7782_8969 395
57 3300042596 Ga0466696_224495 Ga0466696_224495_3022_4209 395
58 3300042596 Ga0466696_394022 Ga0466696_394022_98809_99996 395
59 3300042599 Ga0466706_200638 Ga0466706_200638_7555_8742 395
60 3300042601 Ga0466707_173054 Ga0466707_173054_1159_2346 395
61 3300042610 Ga0466698_342604 Ga0466698_342604_356_1543 395
62 3300042611 Ga0466697_164770 Ga0466697_164770_225_1412 395
63 3300042615 Ga0466711_284098 Ga0466711_284098_4977_6164 395
64 3300042619 Ga0466726_017447 Ga0466726_017447_5128_6315 395
65 3300042620 Ga0466728_391319 Ga0466728_391319_22617_23804 395
66 3300042636 Ga0466703_419148 Ga0466703_419148_3778_4965 395
67 3300042648 Ga0466709_023059 Ga0466709_023059_14158_15345 395
68 3300042652 Ga0466708_056525 Ga0466708_056525_74249_75436 395
69 3300042652 Ga0466708_210902 Ga0466708_210902_1489_2676 395
70 3300042659 Ga0466733_001791 Ga0466733_001791_1925_3112 395
71 iso_pr_bacteria 2923982719 2923984731 395
72 iso_pr_bacteria 2940371297 2940372478 395
73 3300000062 IMNBL1DRAFT_c0004041 IMNBL1DRAFT_00040418 396
74 3300002462 JGI24702J35022_10001361 JGI24702J35022_100013618 396
75 3300002462 JGI24702J35022_10009284 JGI24702J35022_100092845 396
76 3300002462 JGI24702J35022_10123888 JGI24702J35022_101238882 396
77 3300002504 JGI24705J35276_12238730 JGI24705J35276_1223873010 396
78 3300002834 JGI24696J40584_12959080 JGI24696J40584_129590804 396
79 3300005083 Ga0068305_10019648 Ga0068305_100196486 396
80 3300010049 Ga0123356_10070149 Ga0123356_100701492 396
81 3300010167 Ga0123353_10095078 Ga0123353_100950783 396
82 3300042601 Ga0466707_421782 Ga0466707_421782_68_1258 396
83 3300042602 Ga0466713_044512 Ga0466713_044512_1866_3056 396
84 3300042602 Ga0466713_155470 Ga0466713_155470_20003_21193 396
85 3300042624 Ga0466735_085760 Ga0466735_085760_448_1638 396
86 3300042655 Ga0466727_022788 Ga0466727_022788_1553_2743 396
87 3300042590 Ga0466690_138338 Ga0466690_138338_2960_4153 397
88 3300042606 Ga0466719_344505 Ga0466719_344505_2099_3292 397
89 3300042612 Ga0466705_136466 Ga0466705_136466_172_1365 397
90 3300042615 Ga0466711_066442 Ga0466711_066442_84_1277 397
91 3300042618 Ga0466723_045946 Ga0466723_045946_11069_12262 397
92 3300042618 Ga0466723_059094 Ga0466723_059094_6523_7716 397
93 3300042619 Ga0466726_422663 Ga0466726_422663_911_2104 397
94 3300042620 Ga0466728_029447 Ga0466728_029447_5244_6437 397
95 3300042636 Ga0466703_013190 Ga0466703_013190_13589_14782 397
96 3300042652 Ga0466708_148146 Ga0466708_148146_7227_8420 397
97 3300042652 Ga0466708_315337 Ga0466708_315337_5331_6524 397
98 3300042656 Ga0466732_346130 Ga0466732_346130_1932_3125 397
99 3300042590 Ga0466690_276263 Ga0466690_276263_5714_6910 398
100 3300042596 Ga0466696_259711 Ga0466696_259711_20634_21830 398
101 3300042605 Ga0466716_094368 Ga0466716_094368_5254_6450 398
102 3300042612 Ga0466705_464125 Ga0466705_464125_3678_4874 398
103 3300042616 Ga0466715_099718 Ga0466715_099718_5788_6984 398
104 3300042618 Ga0466723_245046 Ga0466723_245046_14903_16099 398
105 3300042618 Ga0466723_302508 Ga0466723_302508_2128_3324 398
106 3300042618 Ga0466723_350295 Ga0466723_350295_142_1338 398
107 3300042636 Ga0466703_057244 Ga0466703_057244_290_1486 398
108 3300042648 Ga0466709_014287 Ga0466709_014287_626_1822 398
109 3300042652 Ga0466708_368256 Ga0466708_368256_12036_13232 398
110 3300042596 Ga0466696_174136 Ga0466696_174136_16042_17244 400
111 3300042605 Ga0466716_033411 Ga0466716_033411_2307_3509 400
112 3300042606 Ga0466719_288509 Ga0466719_288509_1186_2388 400
113 3300042612 Ga0466705_156841 Ga0466705_156841_438_1640 400
114 3300042620 Ga0466728_126600 Ga0466728_126600_2738_3940 400
115 3300042636 Ga0466703_188996 Ga0466703_188996_895_2097 400
116 3300042655 Ga0466727_144223 Ga0466727_144223_4184_5395 403
117 3300042596 Ga0466696_194149 Ga0466696_194149_1971_3191 406
118 3300042593 Ga0466691_012156 Ga0466691_012156_4067_5293 408
119 3300042615 Ga0466711_271146 Ga0466711_271146_4811_6037 408
120 3300042605 Ga0466716_026041 Ga0466716_026041_242_1489 415
121 3300042615 Ga0466711_331356 Ga0466711_331356_2353_3606 417
122 3300042636 Ga0466703_273105 Ga0466703_273105_1136_2389 417
123 3300042659 Ga0466733_056566 Ga0466733_056566_26834_28087 417
124 3300042655 Ga0466727_224853 Ga0466727_224853_16850_18115 421
125 3300042602 Ga0466713_011826 Ga0466713_011826_10873_12141 422
126 3300042619 Ga0466726_063392 Ga0466726_063392_1607_2899 430
127 3300042622 Ga0466731_231417 Ga0466731_231417_793_2112 439

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00155 Aminotran_1_2 Aminotransferase class I and II 43 373 0.91
PF01212 Beta_elim_lyase Beta-eliminating lyase 91 260 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.74 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.