Protein Family IF06372

Metagenome Isolate
109 Members
27 Samples
107 Scaffolds
458.69 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_241314|Ga0466716_241314_1328_2812
Length
494 aa
Sequence
MAAGGSVSERMNIVITGHVDHGKSTLVGRLLADTASLPQGKLQAVKDSCKKNGRVFEYAFLLDALEDEQKQGITIDSARIFFKSALREYLIIDAPGHIEFLRNMLSGASRAVAAVLVIDAVEGVAENSKRHGLLLSLLGISQVLVAVNKLDALDYDEGVFERIKREYGAYLETLKVKPLAFVPVSAREGKNITEGAPAEMPWYRGKTVLEVLDSFYNPSSSGDSPDFRAAFAMPVQDVYRFSNDNDDRRIYAGTVVGGGVSVGDAVSFLPSRKEARIKSIEVWAAPVKTRAVAGEASGFTLEEEIYVKRGEVMXXXXEASPVRAAARLRANVIGLGSRPLGYDRAYLLQLGSEKVVARLEKIARFLGEGGGGGYRELRRHDCGSVILRLARPVAVSSFYENASLGRFVIVDGYDAAGGGIVLESLEPGDEAPDRPRISKDFEEELFAFLKVHFPHRFVNSGRQEGGDLQGLVADEGTALPGGRSVLVKNELCIL

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 53.8%
Termopsidae 15.4%
Rhinotermitidae 11.5%
Unclassified 11.5%
Termitidae 7.7%

🌳 Taxonomy

Archaea 4
Bacteria 103
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
3 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
4 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
27 650716102 Treponema primitia ZAS-2 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466716_241314 3300042605 Bacteria 2989
2 Ga0466719_284700 3300042606 Bacteria 3222
3 Ga0466723_236078 3300042618 Bacteria 3205
4 Ga0466726_041189 3300042619 Bacteria 4314
5 Ga0466726_156790 3300042619 Archaea 1960
6 Ga0466693_146140 3300042592 Bacteria 12529
7 Ga0466709_232251 3300042648 Bacteria 10786
8 Ga0466709_409102 3300042648 Bacteria 9803
9 Ga0466716_114098 3300042605 Bacteria 9273
10 Ga0466722_065265 3300042609 Bacteria 4819
11 Ga0466711_208023 3300042615 Bacteria 35608
12 Ga0466711_256242 3300042615 Bacteria 13056
13 Ga0466715_214788 3300042616 Bacteria 20312
14 Ga0466691_084551 3300042593 Bacteria 7375
15 Ga0466691_218088 3300042593 Bacteria 72508
16 Ga0466696_279698 3300042596 Bacteria 20837
17 Ga0466696_465148 3300042596 Bacteria 18876
18 Ga0466703_321940 3300042636 Bacteria 6714
19 Ga0466704_082232 3300042643 Bacteria 10621
20 Ga0466704_215410 3300042643 Bacteria 21040
21 Ga0466709_063972 3300042648 Bacteria 3954
22 Ga0466709_178089 3300042648 Bacteria 4504
23 Ga0466708_359657 3300042652 Bacteria 31241
24 Ga0466708_426473 3300042652 Bacteria 14533
25 Ga0466719_241021 3300042606 Bacteria 3605
26 Ga0466715_010529 3300042616 Bacteria 11517
27 Ga0466715_400899 3300042616 Bacteria 13959
28 Ga0466726_244232 3300042619 Bacteria 1966
29 Ga0466728_340171 3300042620 Bacteria 2901
30 Ga0466690_019163 3300042590 Bacteria 10570
31 Ga0466690_308914 3300042590 Unclassified 2609
32 Ga0466692_029401 3300042591 Bacteria 33046
33 Ga0466692_033490 3300042591 Bacteria 25185
34 Ga0466696_174001 3300042596 Bacteria 7832
35 Ga0466704_334574 3300042643 Bacteria 23261
36 Ga0466708_046327 3300042652 Bacteria 4082
37 Ga0466708_290635 3300042652 Bacteria 2508
38 Ga0072941_1360386 3300005201 Bacteria 4597
39 Ga0466705_039051 3300042612 Bacteria 14303
40 Ga0466719_042957 3300042606 Bacteria 11596
41 Ga0466719_080366 3300042606 Bacteria 6022
42 Ga0466722_004140 3300042609 Bacteria 2709
43 Ga0466715_130130 3300042616 Bacteria 3919
44 Ga0466726_102305 3300042619 Bacteria 7007
45 Ga0466726_318235 3300042619 Bacteria 1422
46 Ga0466728_255445 3300042620 Bacteria 2117
47 Ga0466728_366055 3300042620 Bacteria 2659
48 Ga0466729_138359 3300042621 Bacteria 3043
49 Ga0466690_045720 3300042590 Bacteria 10753
50 Ga0466692_063408 3300042591 Bacteria 5579
51 Ga0466735_173492 3300042624 Archaea 3316
52 Ga0466703_040076 3300042636 Bacteria 10603
53 Ga0466703_226820 3300042636 Bacteria 4626
54 Ga0466708_175575 3300042652 Bacteria 9563
55 Ga0466727_015712 3300042655 Bacteria 5811
56 Ga0466705_218523 3300042612 Bacteria 1794
57 Ga0466705_258527 3300042612 Bacteria 24461
58 Ga0466707_080214 3300042601 Bacteria 6726
59 Ga0466719_427473 3300042606 Unclassified 4867
60 Ga0466715_638964 3300042616 Bacteria 19632
61 Ga0466726_068780 3300042619 Bacteria 5483
62 Ga0466726_214212 3300042619 Bacteria 5408
63 Ga0466692_200729 3300042591 Bacteria 3701
64 Ga0466691_223202 3300042593 Bacteria 7345
65 Ga0466703_081382 3300042636 Bacteria 31925
66 Ga0466703_363573 3300042636 Bacteria 15833
67 Ga0466727_031161 3300042655 Bacteria 16734
68 Ga0466727_134103 3300042655 Archaea 1702
69 Ga0466727_247803 3300042655 Archaea 2824
70 Ga0466705_014879 3300042612 Bacteria 2683
71 Ga0466719_022407 3300042606 Bacteria 9858
72 Ga0466722_045940 3300042609 Bacteria 10911
73 Ga0466715_609945 3300042616 Bacteria 50733
74 Ga0466726_117645 3300042619 Bacteria 3723
75 Ga0466726_211494 3300042619 Bacteria 13502
76 Ga0466726_325320 3300042619 Bacteria 1619
77 Ga0466691_221593 3300042593 Bacteria 3498
78 Ga0466735_192157 3300042624 Bacteria 3984
79 Ga0466703_206915 3300042636 Bacteria 8728
80 Ga0466704_023869 3300042643 Bacteria 9255
81 Ga0072941_1204108 3300005201 Bacteria 6466
82 Ga0466732_172475 3300042656 Bacteria 59923
83 Ga0466707_050695 3300042601 Bacteria 2439
84 Ga0466719_151223 3300042606 Bacteria 8048
85 Ga0466719_297172 3300042606 Bacteria 8181
86 Ga0466719_321917 3300042606 Bacteria 6302
87 Ga0466711_019938 3300042615 Bacteria 5167
88 Ga0466715_459988 3300042616 Bacteria 8535
89 Ga0466723_027032 3300042618 Bacteria 3276
90 Ga0466723_109317 3300042618 Bacteria 17545
91 Ga0466728_436174 3300042620 Bacteria 8711
92 Ga0466704_159676 3300042643 Bacteria 18888
93 Ga0466704_392542 3300042643 Bacteria 6038
94 Ga0466709_215478 3300042648 Bacteria 19677
95 Ga0466727_279533 3300042655 Bacteria 6568
96 Ga0466716_137730 3300042605 Bacteria 9801
97 Ga0466716_248116 3300042605 Bacteria 2006
98 Ga0466705_425901 3300042612 Bacteria 2486
99 Ga0466723_015261 3300042618 Bacteria 2067
100 Ga0466723_343653 3300042618 Bacteria 7607
101 Ga0466728_162855 3300042620 Bacteria 8346
102 Ga0466690_262373 3300042590 Bacteria 1956
103 Ga0466692_074566 3300042591 Bacteria 31676
104 Ga0466735_071002 3300042624 Bacteria 3629
105 Ga0466727_017937 3300042655 Bacteria 3226
106 Ga0466727_074384 3300042655 Bacteria 6541
107 Ga0068302_10015348 3300005071 Bacteria 8079

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_017937 Ga0466727_017937_1910_3205 431
2 3300042619 Ga0466726_211494 Ga0466726_211494_7830_9191 433
3 3300005071 Ga0068302_10015348 Ga0068302_100153483 434
4 3300042591 Ga0466692_033490 Ga0466692_033490_14739_16061 440
5 3300042609 Ga0466722_004140 Ga0466722_004140_52_1374 440
6 3300042605 Ga0466716_114098 Ga0466716_114098_6228_7562 444
7 3300042619 Ga0466726_214212 Ga0466726_214212_2906_4243 445
8 3300042619 Ga0466726_244232 Ga0466726_244232_49_1386 445
9 3300042624 Ga0466735_173492 Ga0466735_173492_1125_2462 445
10 3300042620 Ga0466728_436174 Ga0466728_436174_1913_3256 447
11 3300042612 Ga0466705_039051 Ga0466705_039051_5734_7080 448
12 3300042618 Ga0466723_343653 Ga0466723_343653_158_1504 448
13 3300042648 Ga0466709_232251 Ga0466709_232251_6314_7660 448
14 3300042606 Ga0466719_284700 Ga0466719_284700_657_2006 449
15 3300042636 Ga0466703_363573 Ga0466703_363573_10410_11759 449
16 3300042643 Ga0466704_334574 Ga0466704_334574_13525_14874 449
17 3300042652 Ga0466708_046327 Ga0466708_046327_680_2050 449
18 3300042593 Ga0466691_084551 Ga0466691_084551_4469_5821 450
19 3300042618 Ga0466723_027032 Ga0466723_027032_1906_3258 450
20 3300042652 Ga0466708_290635 Ga0466708_290635_1009_2361 450
21 3300042590 Ga0466690_308914 Ga0466690_308914_114_1469 451
22 3300042606 Ga0466719_427473 Ga0466719_427473_1930_3285 451
23 3300042616 Ga0466715_010529 Ga0466715_010529_9977_11332 451
24 3300042616 Ga0466715_130130 Ga0466715_130130_2236_3591 451
25 3300042618 Ga0466723_236078 Ga0466723_236078_1672_3027 451
26 3300042619 Ga0466726_325320 Ga0466726_325320_103_1458 451
27 3300042648 Ga0466709_409102 Ga0466709_409102_6031_7386 451
28 3300042590 Ga0466690_045720 Ga0466690_045720_8312_9670 452
29 3300042592 Ga0466693_146140 Ga0466693_146140_5487_6845 452
30 3300042601 Ga0466707_050695 Ga0466707_050695_748_2106 452
31 3300042619 Ga0466726_318235 Ga0466726_318235_13_1371 452
32 3300005201 Ga0072941_1204108 Ga0072941_12041083 453
33 3300042593 Ga0466691_221593 Ga0466691_221593_1561_2994 453
34 iso_pr_bacteria 650716099 650877803 453
35 3300042619 Ga0466726_041189 Ga0466726_041189_525_1889 454
36 3300042618 Ga0466723_015261 Ga0466723_015261_383_1750 455
37 3300042619 Ga0466726_117645 Ga0466726_117645_1893_3260 455
38 3300042620 Ga0466728_340171 Ga0466728_340171_406_1791 455
39 3300042620 Ga0466728_366055 Ga0466728_366055_836_2203 455
40 3300042591 Ga0466692_063408 Ga0466692_063408_2828_4198 456
41 3300042593 Ga0466691_218088 Ga0466691_218088_62015_63385 456
42 3300042596 Ga0466696_279698 Ga0466696_279698_6976_8346 456
43 3300042619 Ga0466726_068780 Ga0466726_068780_1855_3225 456
44 3300042624 Ga0466735_071002 Ga0466735_071002_402_1772 456
45 3300042636 Ga0466703_081382 Ga0466703_081382_30109_31479 456
46 3300042655 Ga0466727_134103 Ga0466727_134103_163_1533 456
47 3300042601 Ga0466707_080214 Ga0466707_080214_1602_2975 457
48 3300042619 Ga0466726_102305 Ga0466726_102305_174_1547 457
49 3300042655 Ga0466727_031161 Ga0466727_031161_6933_8306 457
50 3300042591 Ga0466692_029401 Ga0466692_029401_24118_25494 458
51 3300042606 Ga0466719_080366 Ga0466719_080366_2106_3482 458
52 3300042612 Ga0466705_218523 Ga0466705_218523_200_1576 458
53 3300042616 Ga0466715_609945 Ga0466715_609945_33586_34962 458
54 3300042619 Ga0466726_156790 Ga0466726_156790_297_1703 458
55 3300042636 Ga0466703_206915 Ga0466703_206915_5626_7002 458
56 3300042636 Ga0466703_226820 Ga0466703_226820_1714_3090 458
57 3300042643 Ga0466704_023869 Ga0466704_023869_4293_5669 458
58 3300042643 Ga0466704_159676 Ga0466704_159676_11947_13323 458
59 3300042655 Ga0466727_247803 Ga0466727_247803_1201_2628 458
60 3300042591 Ga0466692_074566 Ga0466692_074566_5903_7282 459
61 3300042648 Ga0466709_063972 Ga0466709_063972_1707_3086 459
62 3300042652 Ga0466708_175575 Ga0466708_175575_7740_9119 459
63 3300042655 Ga0466727_279533 Ga0466727_279533_1748_3127 459
64 3300042590 Ga0466690_019163 Ga0466690_019163_5977_7359 460
65 3300042591 Ga0466692_200729 Ga0466692_200729_1789_3171 460
66 3300042593 Ga0466691_223202 Ga0466691_223202_4958_6340 460
67 3300042596 Ga0466696_174001 Ga0466696_174001_5651_7033 460
68 3300042606 Ga0466719_022407 Ga0466719_022407_7810_9192 460
69 3300042609 Ga0466722_045940 Ga0466722_045940_154_1536 460
70 3300042609 Ga0466722_065265 Ga0466722_065265_1890_3272 460
71 3300042615 Ga0466711_256242 Ga0466711_256242_5804_7186 460
72 3300042618 Ga0466723_109317 Ga0466723_109317_11172_12554 460
73 3300042590 Ga0466690_262373 Ga0466690_262373_38_1480 461
74 3300042616 Ga0466715_400899 Ga0466715_400899_7908_9293 461
75 3300042620 Ga0466728_255445 Ga0466728_255445_455_1840 461
76 3300042648 Ga0466709_178089 Ga0466709_178089_228_1613 461
77 3300042656 Ga0466732_172475 Ga0466732_172475_56373_57758 461
78 iso_pr_bacteria 650716102 650880771 461
79 3300042612 Ga0466705_258527 Ga0466705_258527_16077_17465 462
80 3300042616 Ga0466715_214788 Ga0466715_214788_2018_3406 462
81 3300042636 Ga0466703_040076 Ga0466703_040076_6328_7716 462
82 3300042643 Ga0466704_215410 Ga0466704_215410_6559_7947 462
83 3300042648 Ga0466709_215478 Ga0466709_215478_13352_14740 462
84 3300042655 Ga0466727_015712 Ga0466727_015712_2034_3422 462
85 3300042606 Ga0466719_321917 Ga0466719_321917_152_1546 464
86 3300042596 Ga0466696_465148 Ga0466696_465148_11722_13119 465
87 3300042606 Ga0466719_241021 Ga0466719_241021_1744_3141 465
88 3300042606 Ga0466719_297172 Ga0466719_297172_5696_7093 465
89 3300042636 Ga0466703_321940 Ga0466703_321940_4612_6009 465
90 3300042606 Ga0466719_151223 Ga0466719_151223_5727_7127 466
91 3300042616 Ga0466715_459988 Ga0466715_459988_5897_7297 466
92 3300042624 Ga0466735_192157 Ga0466735_192157_350_1750 466
93 3300042615 Ga0466711_019938 Ga0466711_019938_2811_4214 467
94 3300042605 Ga0466716_248116 Ga0466716_248116_343_1749 468
95 3300005201 Ga0072941_1360386 Ga0072941_13603864 469
96 3300042612 Ga0466705_014879 Ga0466705_014879_831_2273 469
97 3300042612 Ga0466705_425901 Ga0466705_425901_352_1764 470
98 3300042616 Ga0466715_638964 Ga0466715_638964_18169_19587 472
99 3300042605 Ga0466716_137730 Ga0466716_137730_544_1968 474
100 3300042652 Ga0466708_426473 Ga0466708_426473_530_1957 475
101 3300042606 Ga0466719_042957 Ga0466719_042957_9323_10756 477
102 3300042655 Ga0466727_074384 Ga0466727_074384_2235_3668 477
103 3300042620 Ga0466728_162855 Ga0466728_162855_6318_7901 478
104 3300042621 Ga0466729_138359 Ga0466729_138359_301_1737 478
105 3300042643 Ga0466704_392542 Ga0466704_392542_4396_5841 481
106 3300042643 Ga0466704_082232 Ga0466704_082232_7112_8632 485
107 3300042652 Ga0466708_359657 Ga0466708_359657_29289_30758 489
108 3300042605 Ga0466716_241314 Ga0466716_241314_1328_2812 494
109 3300042615 Ga0466711_208023 Ga0466711_208023_20231_21742 503

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22594 GTP-eEF1A_C GTP-eEF1A C-terminal domain-like 328 421 0.92
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 10 215 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.66 0.73 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.