Protein Family IF06359

Metagenome Isolate
123 Members
43 Samples
120 Scaffolds
183.28 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_195372|Ga0466716_195372_10771_11388
Length
205 aa
Sequence
VPLLFYNLIWKAKKQRKYKIMILPVYLYGHPVLREKAKKVPEDYPALKELVTNMFDTMYHAEGVGLAAPQIGLSMRIIVLDGESLSEDFKECKGFKRVMINPVIEAYNDDETLLEEGCLSLPGIHEKVARATRIQLRYADENWVEHNETIEGFAARIVQHEYEHLDGVVFIDNISAIRRQLNKGKLNNIIKGTANCFYRTKVAGK

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 32.6%
Termitidae 30.2%
Unclassified 11.6%
Rhinotermitidae 9.3%
Termopsidae 9.3%
Passalidae 4.7%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 1
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
10 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
38 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
39 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
40 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
41 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
42 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_234961 3300038395 Bacteria 1554
2 Ga0466696_127913 3300042596 Bacteria 17134
3 Ga0466711_062854 3300042615 Bacteria 3126
4 Ga0466715_567151 3300042616 Bacteria 35252
5 Ga0466726_120480 3300042619 Viruses 2198
6 Ga0466728_210135 3300042620 Bacteria 56087
7 Ga0466716_195372 3300042605 Bacteria 22749
8 Ga0466719_448248 3300042606 Bacteria 2036
9 Ga0466704_359414 3300042643 Bacteria 5731
10 Ga0466709_180771 3300042648 Bacteria 2291
11 Ga0466727_203370 3300042655 Bacteria 1958
12 IMNBL1DRAFT_c0011605 3300000062 Bacteria 4101
13 Ga0466705_262482 3300042612 Bacteria 1380
14 Ga0466733_213658 3300042659 Bacteria 1608
15 Ga0456237_0000036 3300041968 Bacteria 19939
16 Ga0466690_320175 3300042590 Bacteria 1852
17 Ga0466692_128376 3300042591 Bacteria 43265
18 Ga0466691_043152 3300042593 Bacteria 12747
19 Ga0466699_366334 3300042597 Bacteria 2324
20 Ga0466711_408129 3300042615 Bacteria 10541
21 Ga0466723_023862 3300042618 Bacteria 63714
22 Ga0466728_020968 3300042620 Bacteria 5749
23 Ga0466707_132881 3300042601 Bacteria 9503
24 Ga0466716_422138 3300042605 Bacteria 1107
25 Ga0466722_113613 3300042609 Bacteria 129604
26 Ga0466722_243490 3300042609 Bacteria 14211
27 Ga0466698_134018 3300042610 Bacteria 1360
28 Ga0466735_203942 3300042624 Bacteria 4108
29 Ga0466709_053373 3300042648 Bacteria 3333
30 Ga0466709_274587 3300042648 Bacteria 1752
31 Ga0466708_120662 3300042652 Bacteria 21101
32 Ga0466708_459966 3300042652 Bacteria 2969
33 Ga0068302_10024513 3300005071 Bacteria 2196
34 Ga0068302_10379155 3300005071 Bacteria 1784
35 Ga0123353_10501513 3300010167 Bacteria 1768
36 Ga0466691_108837 3300042593 Bacteria 1379
37 Ga0466696_212981 3300042596 Bacteria 16619
38 Ga0466705_477699 3300042612 Bacteria 1544
39 Ga0466723_034009 3300042618 Bacteria 10773
40 Ga0466728_009228 3300042620 Bacteria 30460
41 Ga0466728_126349 3300042620 Bacteria 2136
42 Ga0466706_163843 3300042599 Bacteria 10543
43 Ga0466707_022169 3300042601 Bacteria 38620
44 Ga0466713_121362 3300042602 Bacteria 1957
45 Ga0466722_224877 3300042609 Bacteria 3202
46 Ga0466703_213708 3300042636 Bacteria 3979
47 Ga0466704_026770 3300042643 Bacteria 49720
48 Ga0466704_146857 3300042643 Bacteria 17615
49 Ga0466704_168114 3300042643 Bacteria 1441
50 Ga0466727_122414 3300042655 Bacteria 14741
51 JGI24699J35502_11134165 3300002509 Bacteria 42441
52 Ga0068302_10399303 3300005071 Bacteria 4646
53 Ga0123356_10008475 3300010049 Bacteria 10222
54 Ga0123353_10547584 3300010167 Bacteria 1670
55 Ga0466690_059176 3300042590 Bacteria 2405
56 Ga0466712_192535 3300042614 Bacteria 6183
57 Ga0466715_341502 3300042616 Bacteria 5907
58 Ga0466715_563767 3300042616 Bacteria 24196
59 Ga0466728_013726 3300042620 Bacteria 9309
60 Ga0466728_483734 3300042620 Unclassified 4709
61 Ga0466729_112099 3300042621 Bacteria 18792
62 Ga0466716_507390 3300042605 Bacteria 50325
63 Ga0466719_326814 3300042606 Unclassified 1661
64 Ga0466722_093816 3300042609 Bacteria 18976
65 Ga0466704_245507 3300042643 Bacteria 3562
66 Ga0466727_211103 3300042655 Bacteria 6528
67 Ga0466711_137167 3300042615 Bacteria 3214
68 Ga0466711_220936 3300042615 Bacteria 6473
69 Ga0466711_222547 3300042615 Bacteria 19633
70 Ga0466723_270666 3300042618 Bacteria 14190
71 Ga0466723_308413 3300042618 Bacteria 11603
72 Ga0466728_415375 3300042620 Bacteria 16610
73 Ga0466722_102721 3300042609 Bacteria 4595
74 Ga0466731_136263 3300042622 Bacteria 6846
75 Ga0466703_013707 3300042636 Bacteria 4670
76 Ga0466704_420091 3300042643 Bacteria 1314
77 Ga0466708_294636 3300042652 Bacteria 5143
78 JGI24702J35022_10075481 3300002462 Bacteria 1821
79 Ga0123353_10042494 3300010167 Bacteria 7189
80 Ga0466691_167174 3300042593 Bacteria 1965
81 Ga0466705_400972 3300042612 Bacteria 7148
82 Ga0466711_179642 3300042615 Bacteria 5855
83 Ga0466723_001469 3300042618 Bacteria 4123
84 Ga0466713_128805 3300042602 Bacteria 1359
85 Ga0466716_401174 3300042605 Bacteria 2663
86 Ga0466721_274579 3300042608 Bacteria 3902
87 Ga0466709_007784 3300042648 Bacteria 1573
88 JGI24696J40584_12566435 3300002834 Bacteria 635
89 Ga0466705_030623 3300042612 Bacteria 13046
90 Ga0123356_10144821 3300010049 Bacteria 2349
91 Ga0123356_11650172 3300010049 Bacteria 794
92 Ga0466690_294800 3300042590 Bacteria 12770
93 Ga0466711_004876 3300042615 Bacteria 13509
94 Ga0466711_025328 3300042615 Bacteria 13277
95 Ga0466715_186828 3300042616 Bacteria 12554
96 Ga0466726_323795 3300042619 Unclassified 2166
97 Ga0466726_326192 3300042619 Bacteria 3892
98 Ga0466707_416341 3300042601 Bacteria 1542
99 Ga0466721_090348 3300042608 Bacteria 3284
100 Ga0466703_156959 3300042636 Bacteria 7438
101 Ga0466703_387204 3300042636 Bacteria 10307
102 Ga0466709_184980 3300042648 Bacteria 1982
103 Ga0466709_318574 3300042648 Bacteria 87877
104 Ga0466709_412691 3300042648 Bacteria 4861
105 Ga0466727_274505 3300042655 Bacteria 4602
106 JGI24702J35022_10022758 3300002462 Bacteria 3388
107 Ga0068302_10199726 3300005071 Bacteria 1140
108 Ga0466690_029345 3300042590 Bacteria 8622
109 Ga0466690_082281 3300042590 Bacteria 2148
110 Ga0466691_205835 3300042593 Bacteria 1097
111 Ga0466723_101325 3300042618 Bacteria 8442
112 Ga0466726_017616 3300042619 Unclassified 12077
113 Ga0466716_061788 3300042605 Bacteria 14272
114 Ga0466719_430299 3300042606 Unclassified 2526
115 Ga0466703_160950 3300042636 Bacteria 8217
116 Ga0466703_189332 3300042636 Bacteria 1588
117 Ga0466703_214432 3300042636 Bacteria 3316
118 Ga0466725_173460 3300042654 Bacteria 1987
119 2227264150 2225789004 Bacteria 1293
120 JGI24702J35022_10010991 3300002462 Bacteria 5049

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_323795 Ga0466726_323795_1361_1873 170
2 3300042590 Ga0466690_082281 Ga0466690_082281_1229_1747 172
3 3300042590 Ga0466690_320175 Ga0466690_320175_931_1449 172
4 3300042593 Ga0466691_108837 Ga0466691_108837_221_739 172
5 3300042605 Ga0466716_401174 Ga0466716_401174_92_610 172
6 3300042606 Ga0466719_326814 Ga0466719_326814_1122_1640 172
7 3300042618 Ga0466723_034009 Ga0466723_034009_126_644 172
8 3300042618 Ga0466723_101325 Ga0466723_101325_5252_5770 172
9 3300042619 Ga0466726_017616 Ga0466726_017616_8494_9012 172
10 3300042619 Ga0466726_326192 Ga0466726_326192_1011_1529 172
11 3300042620 Ga0466728_009228 Ga0466728_009228_28153_28671 172
12 3300042620 Ga0466728_013726 Ga0466728_013726_7929_8447 172
13 3300042636 Ga0466703_156959 Ga0466703_156959_1899_2417 172
14 3300042652 Ga0466708_459966 Ga0466708_459966_1101_1619 172
15 3300042655 Ga0466727_274505 Ga0466727_274505_3472_3990 172
16 3300042609 Ga0466722_113613 Ga0466722_113613_50942_51499 177
17 3300010049 Ga0123356_11650172 Ga0123356_116501722 179
18 3300042655 Ga0466727_211103 Ga0466727_211103_1766_2311 181
19 2225789004 2227264150 2227711298 182
20 3300005071 Ga0068302_10024513 Ga0068302_100245132 182
21 3300042601 Ga0466707_132881 Ga0466707_132881_8665_9213 182
22 3300038395 Ga0415639_234961 Ga0415639_234961_170_721 183
23 3300042590 Ga0466690_294800 Ga0466690_294800_7792_8343 183
24 3300042593 Ga0466691_167174 Ga0466691_167174_699_1250 183
25 3300042599 Ga0466706_163843 Ga0466706_163843_2177_2728 183
26 3300042601 Ga0466707_022169 Ga0466707_022169_28893_29444 183
27 3300042601 Ga0466707_416341 Ga0466707_416341_915_1466 183
28 3300042605 Ga0466716_422138 Ga0466716_422138_493_1044 183
29 3300042606 Ga0466719_430299 Ga0466719_430299_17_568 183
30 3300042606 Ga0466719_448248 Ga0466719_448248_450_1001 183
31 3300042609 Ga0466722_243490 Ga0466722_243490_10792_11343 183
32 3300042610 Ga0466698_134018 Ga0466698_134018_330_881 183
33 3300042612 Ga0466705_400972 Ga0466705_400972_5744_6295 183
34 3300042615 Ga0466711_137167 Ga0466711_137167_712_1263 183
35 3300042616 Ga0466715_341502 Ga0466715_341502_1813_2364 183
36 3300042618 Ga0466723_001469 Ga0466723_001469_442_993 183
37 3300042618 Ga0466723_270666 Ga0466723_270666_6424_6975 183
38 3300042620 Ga0466728_020968 Ga0466728_020968_4386_4937 183
39 3300042620 Ga0466728_210135 Ga0466728_210135_6518_7069 183
40 3300042620 Ga0466728_483734 Ga0466728_483734_2428_2979 183
41 3300042636 Ga0466703_013707 Ga0466703_013707_1315_1866 183
42 3300042648 Ga0466709_007784 Ga0466709_007784_791_1342 183
43 3300042648 Ga0466709_053373 Ga0466709_053373_1418_1969 183
44 3300042648 Ga0466709_184980 Ga0466709_184980_932_1483 183
45 3300042648 Ga0466709_274587 Ga0466709_274587_812_1363 183
46 3300000062 IMNBL1DRAFT_c0011605 IMNBL1DRAFT_00116054 184
47 3300005071 Ga0068302_10379155 Ga0068302_103791552 184
48 3300005071 Ga0068302_10399303 Ga0068302_103993032 184
49 3300042596 Ga0466696_127913 Ga0466696_127913_11162_11716 184
50 3300042608 Ga0466721_274579 Ga0466721_274579_1625_2179 184
51 3300042614 Ga0466712_192535 Ga0466712_192535_3560_4114 184
52 3300042652 Ga0466708_120662 Ga0466708_120662_5981_6535 184
53 iso_pr_bacteria 2820757377 2820759982 184
54 3300041968 Ga0456237_0000036 Ga0456237_0000036_3463_4020 185
55 3300042590 Ga0466690_029345 Ga0466690_029345_3605_4162 185
56 3300042590 Ga0466690_059176 Ga0466690_059176_506_1063 185
57 3300042593 Ga0466691_043152 Ga0466691_043152_1988_2545 185
58 3300042593 Ga0466691_205835 Ga0466691_205835_514_1071 185
59 3300042596 Ga0466696_212981 Ga0466696_212981_7566_8123 185
60 3300042597 Ga0466699_366334 Ga0466699_366334_1478_2035 185
61 3300042602 Ga0466713_121362 Ga0466713_121362_66_623 185
62 3300042605 Ga0466716_061788 Ga0466716_061788_1910_2467 185
63 3300042605 Ga0466716_507390 Ga0466716_507390_34661_35218 185
64 3300042608 Ga0466721_090348 Ga0466721_090348_1639_2196 185
65 3300042609 Ga0466722_102721 Ga0466722_102721_3435_3992 185
66 3300042612 Ga0466705_262482 Ga0466705_262482_617_1174 185
67 3300042612 Ga0466705_477699 Ga0466705_477699_969_1526 185
68 3300042615 Ga0466711_004876 Ga0466711_004876_5393_5950 185
69 3300042615 Ga0466711_025328 Ga0466711_025328_4897_5454 185
70 3300042615 Ga0466711_062854 Ga0466711_062854_2142_2699 185
71 3300042615 Ga0466711_179642 Ga0466711_179642_4841_5398 185
72 3300042615 Ga0466711_222547 Ga0466711_222547_6764_7321 185
73 3300042615 Ga0466711_408129 Ga0466711_408129_8192_8749 185
74 3300042616 Ga0466715_186828 Ga0466715_186828_4139_4696 185
75 3300042616 Ga0466715_563767 Ga0466715_563767_10498_11055 185
76 3300042616 Ga0466715_567151 Ga0466715_567151_26938_27495 185
77 3300042618 Ga0466723_023862 Ga0466723_023862_42597_43154 185
78 3300042619 Ga0466726_120480 Ga0466726_120480_150_707 185
79 3300042620 Ga0466728_415375 Ga0466728_415375_12010_12567 185
80 3300042621 Ga0466729_112099 Ga0466729_112099_11091_11648 185
81 3300042622 Ga0466731_136263 Ga0466731_136263_5184_5741 185
82 3300042624 Ga0466735_203942 Ga0466735_203942_2081_2638 185
83 3300042636 Ga0466703_160950 Ga0466703_160950_5705_6262 185
84 3300042636 Ga0466703_189332 Ga0466703_189332_709_1266 185
85 3300042636 Ga0466703_214432 Ga0466703_214432_489_1046 185
86 3300042636 Ga0466703_387204 Ga0466703_387204_3625_4182 185
87 3300042643 Ga0466704_026770 Ga0466704_026770_12084_12641 185
88 3300042643 Ga0466704_146857 Ga0466704_146857_10108_10665 185
89 3300042643 Ga0466704_168114 Ga0466704_168114_556_1113 185
90 3300042643 Ga0466704_245507 Ga0466704_245507_666_1223 185
91 3300042643 Ga0466704_359414 Ga0466704_359414_730_1287 185
92 3300042648 Ga0466709_180771 Ga0466709_180771_792_1349 185
93 3300042648 Ga0466709_412691 Ga0466709_412691_3048_3605 185
94 3300042652 Ga0466708_294636 Ga0466708_294636_3611_4168 185
95 3300042654 Ga0466725_173460 Ga0466725_173460_1275_1832 185
96 3300042655 Ga0466727_122414 Ga0466727_122414_3781_4338 185
97 3300042655 Ga0466727_203370 Ga0466727_203370_879_1436 185
98 3300042659 Ga0466733_213658 Ga0466733_213658_437_994 185
99 iso_pr_bacteria 2820744581 2820746264 185
100 iso_pr_bacteria 2820765201 2820766151 185
101 3300002462 JGI24702J35022_10022758 JGI24702J35022_100227583 186
102 3300002462 JGI24702J35022_10075481 JGI24702J35022_100754813 186
103 3300002834 JGI24696J40584_12566435 JGI24696J40584_125664351 186
104 3300010049 Ga0123356_10144821 Ga0123356_101448212 186
105 3300010167 Ga0123353_10042494 Ga0123353_100424943 186
106 3300010167 Ga0123353_10501513 Ga0123353_105015132 186
107 3300010167 Ga0123353_10547584 Ga0123353_105475842 186
108 3300042591 Ga0466692_128376 Ga0466692_128376_12483_13043 186
109 3300042602 Ga0466713_128805 Ga0466713_128805_516_1076 186
110 3300042609 Ga0466722_093816 Ga0466722_093816_16416_16976 186
111 3300042609 Ga0466722_224877 Ga0466722_224877_2493_3053 186
112 3300002462 JGI24702J35022_10010991 JGI24702J35022_100109915 187
113 3300002509 JGI24699J35502_11134165 JGI24699J35502_111341653 187
114 3300005071 Ga0068302_10199726 Ga0068302_101997262 187
115 3300010049 Ga0123356_10008475 Ga0123356_100084753 187
116 3300042612 Ga0466705_030623 Ga0466705_030623_8980_9546 188
117 3300042636 Ga0466703_213708 Ga0466703_213708_2573_3139 188
118 3300042643 Ga0466704_420091 Ga0466704_420091_672_1238 188
119 3300042618 Ga0466723_308413 Ga0466723_308413_6610_7179 189
120 3300042620 Ga0466728_126349 Ga0466728_126349_421_990 189
121 3300042615 Ga0466711_220936 Ga0466711_220936_854_1426 190
122 3300042648 Ga0466709_318574 Ga0466709_318574_69442_70023 193
123 3300042605 Ga0466716_195372 Ga0466716_195372_10771_11388 205

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01327 Pep_deformylase Polypeptide deformylase 23 179 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01327 GO:0042586 peptide deformylase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.