Protein Family IF06355
Metagenome
Isolate
167
Members
88
Samples
126
Scaffolds
342.22
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_169667|Ga0466716_169667_4607_5722
- Length
- 371 aa
- Sequence
- MIFKIYHFEHLNRYEQYLHALKLIIMIDNNASVLLIYTGGTIGMIEDEETNALKPFNFNYLKEYVPELNRLKFNIDSIQFKNPIDSSDMNPDKWKKIVWIIEDNYDKYDGFVVLHGTDTMAYSASALSFMLENLNKPVILTGSQLPIGKIRTDGKENLITALEIAVDKDADGNVFVTEVCVFFQNLLMRGNRTTKINAANFKAFNSFNFPILAEAGTYIRYRHELMHRPLRNSKPKFHYPLDSNVAIVKLFPGISAEILKAMIGIPHLKAIVLETYGAGNAPSETWFLDIIAEAVKKGIVVVNVTQCASGSVEMERYQAGKALKDIGVLSGYDITTEAAVAKLMFLFGLGLDRKEVKMYMKMSLVGEITVE
Sample Types
Isolate
24.6%
Metagenome
75.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
20.2%
Termitidae
17.9%
Kalotermitidae
16.7%
Unclassified
13.1%
Ixodidae
6.0%
Argasidae
4.8%
Rhinotermitidae
3.6%
Drosophilidae
3.6%
Apidae
3.6%
Termopsidae
3.6%
Formicidae
2.4%
Tenebrionidae
2.4%
Hodotermitidae
1.2%
Passalidae
1.2%
Taxonomy
Archaea
0
Bacteria
164
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2791354885 | Francisella endosymbiont of Ornithodoros moubata FLE-Om | Isolate | Argasidae |
| 2 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 3 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 4 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 5 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 6 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 9 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 21 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 22 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 23 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 24 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 25 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 26 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 27 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 28 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 29 | 2788500057 | Francisella-like endosymbiont F-Om | Isolate | Argasidae |
| 30 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 31 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 32 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 33 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 37 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 43 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 44 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 47 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 48 | 2791354884 | Francisella endosymbiont of Amblyomma maculatum FLE-Am | Isolate | Ixodidae |
| 49 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 50 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 51 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 57 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 58 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 59 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 60 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 61 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 62 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 63 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 64 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 65 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 66 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 67 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 68 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 69 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 70 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 71 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 72 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 73 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 74 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 75 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 76 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 77 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 78 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 79 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 80 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 81 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 82 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 83 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 84 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 85 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 86 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 87 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 88 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466727_351301 | 3300042655 | Bacteria | 1882 |
| 2 | Ga0466710_255028 | 3300042613 | Bacteria | 2012 |
| 3 | Ga0466723_016779 | 3300042618 | Bacteria | 10302 |
| 4 | Ga0466728_192213 | 3300042620 | Bacteria | 14486 |
| 5 | Ga0466707_056197 | 3300042601 | Bacteria | 16804 |
| 6 | Ga0466707_203352 | 3300042601 | Bacteria | 1192 |
| 7 | Ga0466714_095116 | 3300042603 | Bacteria | 10910 |
| 8 | Ga0123354_10000260 | 3300010882 | Bacteria | 47442 |
| 9 | Ga0123354_10164637 | 3300010882 | Bacteria | 2614 |
| 10 | Ga0466696_167063 | 3300042596 | Bacteria | 2271 |
| 11 | Ga0466703_066273 | 3300042636 | Bacteria | 18736 |
| 12 | Ga0466704_547544 | 3300042643 | Bacteria | 2651 |
| 13 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 14 | Ga0068305_10036503 | 3300005083 | Bacteria | 3978 |
| 15 | Ga0104045_1019274 | 3300007085 | Bacteria | 6317 |
| 16 | Ga0466697_113153 | 3300042611 | Bacteria | 5971 |
| 17 | Ga0466712_221216 | 3300042614 | Bacteria | 3645 |
| 18 | Ga0466711_502376 | 3300042615 | Bacteria | 2599 |
| 19 | Ga0466723_316414 | 3300042618 | Unclassified | 6253 |
| 20 | Ga0466713_089027 | 3300042602 | Bacteria | 2282 |
| 21 | Ga0466714_099430 | 3300042603 | Bacteria | 20750 |
| 22 | Ga0466719_094471 | 3300042606 | Bacteria | 2385 |
| 23 | Ga0466690_036908 | 3300042590 | Bacteria | 13610 |
| 24 | Ga0466691_132752 | 3300042593 | Bacteria | 7896 |
| 25 | Ga0466735_110970 | 3300042624 | Bacteria | 2066 |
| 26 | Ga0466703_413604 | 3300042636 | Bacteria | 28970 |
| 27 | IMNBL1DRAFT_c0000189 | 3300000062 | Bacteria | 53989 |
| 28 | Ga0072941_1014146 | 3300005201 | Bacteria | 11153 |
| 29 | Ga0104048_1004487 | 3300007143 | Bacteria | 2347 |
| 30 | Ga0104048_1168863 | 3300007143 | Bacteria | 2705 |
| 31 | Ga0104019_1030529 | 3300007150 | Unclassified | 6110 |
| 32 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 33 | Ga0466707_062515 | 3300042601 | Bacteria | 19268 |
| 34 | Ga0466713_011249 | 3300042602 | Bacteria | 73032 |
| 35 | Ga0466713_061076 | 3300042602 | Bacteria | 17239 |
| 36 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 37 | Ga0466716_160849 | 3300042605 | Bacteria | 5839 |
| 38 | Ga0123357_10008856 | 3300009784 | Bacteria | 12635 |
| 39 | Ga0466690_291646 | 3300042590 | Bacteria | 10446 |
| 40 | Ga0466692_158670 | 3300042591 | Bacteria | 3461 |
| 41 | Ga0466701_013027 | 3300042598 | Bacteria | 25926 |
| 42 | Ga0466729_310352 | 3300042621 | Bacteria | 3151 |
| 43 | Ga0466709_214835 | 3300042648 | Bacteria | 15492 |
| 44 | Ga0466709_406099 | 3300042648 | Bacteria | 7547 |
| 45 | Ga0466727_081347 | 3300042655 | Bacteria | 65648 |
| 46 | JGI24702J35022_10028121 | 3300002462 | Bacteria | 3023 |
| 47 | JGI24696J40584_12947310 | 3300002834 | Bacteria | 1941 |
| 48 | Ga0104045_1017615 | 3300007085 | Unclassified | 1830 |
| 49 | Ga0104048_1169722 | 3300007143 | Bacteria | 1914 |
| 50 | Ga0103267_1000234 | 3300007190 | Bacteria | 52769 |
| 51 | Ga0466705_154115 | 3300042612 | Bacteria | 8673 |
| 52 | Ga0466715_219724 | 3300042616 | Bacteria | 5160 |
| 53 | Ga0466715_473208 | 3300042616 | Bacteria | 3744 |
| 54 | Ga0466728_057917 | 3300042620 | Bacteria | 5997 |
| 55 | Ga0466701_030109 | 3300042598 | Bacteria | 2587 |
| 56 | Ga0466706_160331 | 3300042599 | Bacteria | 28148 |
| 57 | Ga0466716_169667 | 3300042605 | Bacteria | 6683 |
| 58 | Ga0466719_397662 | 3300042606 | Bacteria | 8984 |
| 59 | Ga0466720_065266 | 3300042607 | Bacteria | 1281 |
| 60 | Ga0466722_197557 | 3300042609 | Bacteria | 5381 |
| 61 | Ga0466691_004508 | 3300042593 | Bacteria | 44771 |
| 62 | Ga0466691_051682 | 3300042593 | Bacteria | 5759 |
| 63 | Ga0466691_227739 | 3300042593 | Bacteria | 10833 |
| 64 | Ga0466729_310165 | 3300042621 | Bacteria | 1402 |
| 65 | Ga0466735_170604 | 3300042624 | Bacteria | 35167 |
| 66 | Ga0466704_002412 | 3300042643 | Bacteria | 2325 |
| 67 | Ga0466709_187563 | 3300042648 | Bacteria | 2797 |
| 68 | Ga0466708_004159 | 3300042652 | Bacteria | 10215 |
| 69 | Ga0466727_003866 | 3300042655 | Bacteria | 2119 |
| 70 | JGI24702J35022_10001285 | 3300002462 | Bacteria | 15643 |
| 71 | JGI24702J35022_10002552 | 3300002462 | Bacteria | 11078 |
| 72 | Ga0103267_1000614 | 3300007190 | Bacteria | 18974 |
| 73 | Ga0466733_049217 | 3300042659 | Bacteria | 2896 |
| 74 | Ga0466726_012021 | 3300042619 | Bacteria | 19051 |
| 75 | Ga0466701_019294 | 3300042598 | Bacteria | 10174 |
| 76 | Ga0466701_075478 | 3300042598 | Bacteria | 63169 |
| 77 | Ga0466706_114959 | 3300042599 | Bacteria | 66212 |
| 78 | Ga0466713_047364 | 3300042602 | Bacteria | 10315 |
| 79 | Ga0466713_111867 | 3300042602 | Bacteria | 3032 |
| 80 | Ga0466719_222593 | 3300042606 | Bacteria | 2974 |
| 81 | Ga0466719_253777 | 3300042606 | Bacteria | 6074 |
| 82 | Ga0123357_10205653 | 3300009784 | Bacteria | 2227 |
| 83 | Ga0466692_095765 | 3300042591 | Bacteria | 12783 |
| 84 | Ga0466735_165517 | 3300042624 | Bacteria | 3246 |
| 85 | Ga0466703_036580 | 3300042636 | Bacteria | 4789 |
| 86 | Ga0466703_228038 | 3300042636 | Bacteria | 2383 |
| 87 | Ga0466709_180554 | 3300042648 | Bacteria | 66844 |
| 88 | Ga0103267_1000155 | 3300007190 | Bacteria | 26888 |
| 89 | Ga0466705_038929 | 3300042612 | Bacteria | 1391 |
| 90 | Ga0466715_372837 | 3300042616 | Bacteria | 4798 |
| 91 | Ga0466715_392477 | 3300042616 | Bacteria | 4308 |
| 92 | Ga0466726_130242 | 3300042619 | Bacteria | 6161 |
| 93 | Ga0466726_465964 | 3300042619 | Bacteria | 1877 |
| 94 | Ga0466701_036771 | 3300042598 | Bacteria | 249987 |
| 95 | Ga0466719_182496 | 3300042606 | Bacteria | 1829 |
| 96 | Ga0466722_241031 | 3300042609 | Bacteria | 3196 |
| 97 | Ga0123357_10004577 | 3300009784 | Bacteria | 16283 |
| 98 | Ga0123357_10292822 | 3300009784 | Bacteria | 1659 |
| 99 | Ga0123353_10365576 | 3300010167 | Bacteria | 2166 |
| 100 | Ga0466691_036662 | 3300042593 | Bacteria | 15520 |
| 101 | Ga0466735_073812 | 3300042624 | Bacteria | 1616 |
| 102 | Ga0466708_031325 | 3300042652 | Bacteria | 12155 |
| 103 | Ga0103268_1000018 | 3300007192 | Bacteria | 53707 |
| 104 | Ga0466711_071000 | 3300042615 | Bacteria | 20492 |
| 105 | Ga0466707_383332 | 3300042601 | Bacteria | 4772 |
| 106 | Ga0466722_208572 | 3300042609 | Bacteria | 4310 |
| 107 | Ga0123356_10218714 | 3300010049 | Bacteria | 1959 |
| 108 | Ga0123354_10001398 | 3300010882 | Bacteria | 29178 |
| 109 | Ga0123354_10192464 | 3300010882 | Bacteria | 2277 |
| 110 | Ga0466696_074170 | 3300042596 | Bacteria | 7980 |
| 111 | Ga0466729_253159 | 3300042621 | Bacteria | 7380 |
| 112 | Ga0466703_233333 | 3300042636 | Bacteria | 4041 |
| 113 | Ga0466727_006091 | 3300042655 | Bacteria | 5923 |
| 114 | Ga0466723_090449 | 3300042618 | Bacteria | 1914 |
| 115 | Ga0466729_142222 | 3300042621 | Bacteria | 7476 |
| 116 | Ga0466701_093365 | 3300042598 | Bacteria | 1554 |
| 117 | Ga0466707_082799 | 3300042601 | Bacteria | 3224 |
| 118 | Ga0466707_316195 | 3300042601 | Bacteria | 16187 |
| 119 | Ga0123356_10021087 | 3300010049 | Bacteria | 6160 |
| 120 | Ga0123354_10284923 | 3300010882 | Bacteria | 1596 |
| 121 | Ga0466692_103324 | 3300042591 | Bacteria | 13043 |
| 122 | Ga0466692_146653 | 3300042591 | Bacteria | 22871 |
| 123 | Ga0466731_335264 | 3300042622 | Bacteria | 1005 |
| 124 | Ga0466703_255046 | 3300042636 | Bacteria | 11230 |
| 125 | Ga0466703_295726 | 3300042636 | Bacteria | 4328 |
| 126 | IMNBL1DRAFT_c0018314 | 3300000062 | Bacteria | 2916 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300007190 | Ga0103267_1000614 | Ga0103267_10006149 | 311 |
| 2 | 3300042622 | Ga0466731_335264 | Ga0466731_335264_11_952 | 313 |
| 3 | 3300042636 | Ga0466703_066273 | Ga0466703_066273_2602_3642 | 321 |
| 4 | 3300042607 | Ga0466720_065266 | Ga0466720_065266_162_1136 | 324 |
| 5 | 3300042636 | Ga0466703_255046 | Ga0466703_255046_924_1904 | 326 |
| 6 | 3300010049 | Ga0123356_10218714 | Ga0123356_102187142 | 328 |
| 7 | 3300042605 | Ga0466716_160849 | Ga0466716_160849_4058_5044 | 328 |
| 8 | 3300042606 | Ga0466719_253777 | Ga0466719_253777_3536_4522 | 328 |
| 9 | 3300042609 | Ga0466722_208572 | Ga0466722_208572_1116_2102 | 328 |
| 10 | 3300042636 | Ga0466703_228038 | Ga0466703_228038_13_999 | 328 |
| 11 | iso_pr_bacteria | 2922326829 | 2922328717 | 328 |
| 12 | 3300042636 | Ga0466703_233333 | Ga0466703_233333_1996_2985 | 329 |
| 13 | 3300042636 | Ga0466703_036580 | Ga0466703_036580_2737_3729 | 330 |
| 14 | iso_pr_bacteria | 2791354884 | 2791841906 | 332 |
| 15 | iso_pr_bacteria | 2940264388 | 2940266262 | 332 |
| 16 | iso_pr_bacteria | 2940267548 | 2940269354 | 332 |
| 17 | iso_pr_bacteria | 2940270707 | 2940272513 | 332 |
| 18 | iso_pr_bacteria | 2940273867 | 2940275680 | 332 |
| 19 | 3300056842 | Ga0562377_0006 | Ga0562377_0006_1486313_1487317 | 334 |
| 20 | 3300010882 | Ga0123354_10000260 | Ga0123354_100002609 | 335 |
| 21 | 3300042615 | Ga0466711_071000 | Ga0466711_071000_14106_15113 | 335 |
| 22 | 3300002462 | JGI24702J35022_10028121 | JGI24702J35022_100281213 | 336 |
| 23 | 3300042599 | Ga0466706_160331 | Ga0466706_160331_7633_8643 | 336 |
| 24 | iso_pr_bacteria | 2582581321 | 2585353711 | 336 |
| 25 | iso_pr_bacteria | 2833478085 | 2833479405 | 336 |
| 26 | 3300042599 | Ga0466706_114959 | Ga0466706_114959_59188_60201 | 337 |
| 27 | 3300042614 | Ga0466712_221216 | Ga0466712_221216_1209_2222 | 337 |
| 28 | 3300042655 | Ga0466727_351301 | Ga0466727_351301_628_1641 | 337 |
| 29 | 3300042601 | Ga0466707_383332 | Ga0466707_383332_2298_3314 | 338 |
| 30 | 3300042603 | Ga0466714_095116 | Ga0466714_095116_8945_9964 | 339 |
| 31 | 3300042603 | Ga0466714_099430 | Ga0466714_099430_4034_5053 | 339 |
| 32 | 3300042619 | Ga0466726_130242 | Ga0466726_130242_1148_2167 | 339 |
| 33 | iso_pr_bacteria | 2556921622 | 2558101968 | 339 |
| 34 | iso_pr_bacteria | 2785510743 | 2785736303 | 339 |
| 35 | iso_pr_bacteria | 2940230426 | 2940232970 | 339 |
| 36 | iso_pr_bacteria | 2940233634 | 2940236156 | 339 |
| 37 | iso_pr_bacteria | 2940277027 | 2940278232 | 339 |
| 38 | iso_pr_bacteria | 2940280053 | 2940281049 | 339 |
| 39 | iso_pr_bacteria | 2940283334 | 2940285859 | 339 |
| 40 | iso_pr_bacteria | 2940286528 | 2940289066 | 339 |
| 41 | iso_pr_bacteria | 2940289514 | 2940290284 | 339 |
| 42 | iso_pr_bacteria | 2940292506 | 2940293316 | 339 |
| 43 | iso_pr_bacteria | 2940295490 | 2940296299 | 339 |
| 44 | iso_pr_bacteria | 2944625312 | 2944626345 | 339 |
| 45 | 3300007190 | Ga0103267_1000155 | Ga0103267_10001551 | 340 |
| 46 | iso_pr_bacteria | 2799112231 | 2799234259 | 340 |
| 47 | iso_pr_bacteria | 2832298047 | 2832299605 | 340 |
| 48 | 3300007190 | Ga0103267_1000234 | Ga0103267_100023411 | 341 |
| 49 | 3300042593 | Ga0466691_036662 | Ga0466691_036662_3995_5176 | 341 |
| 50 | iso_pr_bacteria | 2899132286 | 2899132516 | 341 |
| 51 | 3300002834 | JGI24696J40584_12947310 | JGI24696J40584_129473102 | 342 |
| 52 | 3300007143 | Ga0104048_1004487 | Ga0104048_10044873 | 342 |
| 53 | 3300042590 | Ga0466690_036908 | Ga0466690_036908_8695_9723 | 342 |
| 54 | 3300042593 | Ga0466691_132752 | Ga0466691_132752_5506_6534 | 342 |
| 55 | 3300042593 | Ga0466691_227739 | Ga0466691_227739_7253_8281 | 342 |
| 56 | 3300042598 | Ga0466701_019294 | Ga0466701_019294_49_1077 | 342 |
| 57 | 3300042598 | Ga0466701_036771 | Ga0466701_036771_152565_153593 | 342 |
| 58 | 3300042606 | Ga0466719_094471 | Ga0466719_094471_1311_2339 | 342 |
| 59 | 3300042611 | Ga0466697_113153 | Ga0466697_113153_1030_2058 | 342 |
| 60 | 3300042612 | Ga0466705_154115 | Ga0466705_154115_1569_2597 | 342 |
| 61 | 3300042616 | Ga0466715_372837 | Ga0466715_372837_2451_3479 | 342 |
| 62 | 3300042616 | Ga0466715_392477 | Ga0466715_392477_831_1859 | 342 |
| 63 | 3300042618 | Ga0466723_016779 | Ga0466723_016779_4030_5058 | 342 |
| 64 | 3300042620 | Ga0466728_057917 | Ga0466728_057917_384_1412 | 342 |
| 65 | 3300042620 | Ga0466728_192213 | Ga0466728_192213_5043_6071 | 342 |
| 66 | 3300042643 | Ga0466704_547544 | Ga0466704_547544_260_1288 | 342 |
| 67 | 3300042648 | Ga0466709_214835 | Ga0466709_214835_10637_11665 | 342 |
| 68 | 3300042648 | Ga0466709_406099 | Ga0466709_406099_3199_4227 | 342 |
| 69 | 3300042652 | Ga0466708_031325 | Ga0466708_031325_4413_5441 | 342 |
| 70 | iso_pr_bacteria | 2772190782 | 2772999438 | 342 |
| 71 | iso_pr_bacteria | 2806310685 | 2807226707 | 342 |
| 72 | iso_pr_bacteria | 2820736622 | 2820737140 | 342 |
| 73 | iso_pr_bacteria | 2820740053 | 2820740972 | 342 |
| 74 | 3300002462 | JGI24702J35022_10001285 | JGI24702J35022_1000128517 | 343 |
| 75 | 3300007085 | Ga0104045_1017615 | Ga0104045_10176151 | 343 |
| 76 | 3300007085 | Ga0104045_1019274 | Ga0104045_10192746 | 343 |
| 77 | 3300007143 | Ga0104048_1168863 | Ga0104048_11688632 | 343 |
| 78 | 3300007143 | Ga0104048_1169722 | Ga0104048_11697221 | 343 |
| 79 | 3300007150 | Ga0104019_1030529 | Ga0104019_10305298 | 343 |
| 80 | 3300042598 | Ga0466701_075478 | Ga0466701_075478_28508_29539 | 343 |
| 81 | 3300042598 | Ga0466701_093365 | Ga0466701_093365_13_1044 | 343 |
| 82 | 3300042649 | Ga0466724_28891 | Ga0466724_28891_25563_26594 | 343 |
| 83 | 3300042606 | Ga0466719_222593 | Ga0466719_222593_396_1430 | 344 |
| 84 | 3300042609 | Ga0466722_197557 | Ga0466722_197557_1693_2727 | 344 |
| 85 | 3300042616 | Ga0466715_219724 | Ga0466715_219724_2681_3715 | 344 |
| 86 | 3300042621 | Ga0466729_310165 | Ga0466729_310165_290_1324 | 344 |
| 87 | iso_pr_bacteria | 2920168565 | 2920169408 | 344 |
| 88 | 3300002462 | JGI24702J35022_10002552 | JGI24702J35022_1000255211 | 345 |
| 89 | 3300007192 | Ga0103268_1000018 | Ga0103268_100001816 | 345 |
| 90 | 3300009784 | Ga0123357_10292822 | Ga0123357_102928222 | 345 |
| 91 | 3300042591 | Ga0466692_095765 | Ga0466692_095765_10663_11700 | 345 |
| 92 | 3300042636 | Ga0466703_295726 | Ga0466703_295726_1232_2269 | 345 |
| 93 | iso_pr_bacteria | 2506210010 | 2506290387 | 345 |
| 94 | iso_pr_bacteria | 2506210015 | 2506300897 | 345 |
| 95 | iso_pr_bacteria | 2871564055 | 2871564111 | 345 |
| 96 | iso_pr_bacteria | 2871595141 | 2871596862 | 345 |
| 97 | iso_pr_bacteria | 2874203443 | 2874203498 | 345 |
| 98 | iso_pr_bacteria | 2874209778 | 2874209875 | 345 |
| 99 | iso_pr_bacteria | 2940216256 | 2940216620 | 345 |
| 100 | iso_pr_bacteria | 637000113 | 638060033 | 345 |
| 101 | 3300009784 | Ga0123357_10004577 | Ga0123357_100045778 | 346 |
| 102 | 3300009784 | Ga0123357_10008856 | Ga0123357_100088567 | 346 |
| 103 | 3300009784 | Ga0123357_10205653 | Ga0123357_102056532 | 346 |
| 104 | 3300010882 | Ga0123354_10001398 | Ga0123354_100013983 | 346 |
| 105 | 3300010882 | Ga0123354_10164637 | Ga0123354_101646372 | 346 |
| 106 | 3300010882 | Ga0123354_10192464 | Ga0123354_101924642 | 346 |
| 107 | 3300042590 | Ga0466690_291646 | Ga0466690_291646_5812_6852 | 346 |
| 108 | 3300042591 | Ga0466692_103324 | Ga0466692_103324_11660_12700 | 346 |
| 109 | 3300042591 | Ga0466692_146653 | Ga0466692_146653_17780_18820 | 346 |
| 110 | 3300042591 | Ga0466692_158670 | Ga0466692_158670_428_1468 | 346 |
| 111 | 3300042593 | Ga0466691_004508 | Ga0466691_004508_18533_19573 | 346 |
| 112 | 3300042596 | Ga0466696_074170 | Ga0466696_074170_4194_5234 | 346 |
| 113 | 3300042596 | Ga0466696_167063 | Ga0466696_167063_1202_2242 | 346 |
| 114 | 3300042598 | Ga0466701_013027 | Ga0466701_013027_13665_14705 | 346 |
| 115 | 3300042598 | Ga0466701_030109 | Ga0466701_030109_385_1425 | 346 |
| 116 | 3300042601 | Ga0466707_056197 | Ga0466707_056197_8224_9264 | 346 |
| 117 | 3300042601 | Ga0466707_062515 | Ga0466707_062515_9441_10481 | 346 |
| 118 | 3300042601 | Ga0466707_082799 | Ga0466707_082799_351_1391 | 346 |
| 119 | 3300042601 | Ga0466707_203352 | Ga0466707_203352_57_1097 | 346 |
| 120 | 3300042601 | Ga0466707_316195 | Ga0466707_316195_8621_9661 | 346 |
| 121 | 3300042602 | Ga0466713_047364 | Ga0466713_047364_4865_5905 | 346 |
| 122 | 3300042612 | Ga0466705_038929 | Ga0466705_038929_250_1290 | 346 |
| 123 | 3300042615 | Ga0466711_502376 | Ga0466711_502376_177_1217 | 346 |
| 124 | 3300042616 | Ga0466715_473208 | Ga0466715_473208_1947_2987 | 346 |
| 125 | 3300042618 | Ga0466723_090449 | Ga0466723_090449_784_1824 | 346 |
| 126 | 3300042618 | Ga0466723_316414 | Ga0466723_316414_663_1703 | 346 |
| 127 | 3300042619 | Ga0466726_465964 | Ga0466726_465964_506_1546 | 346 |
| 128 | 3300042621 | Ga0466729_142222 | Ga0466729_142222_634_1674 | 346 |
| 129 | 3300042621 | Ga0466729_310352 | Ga0466729_310352_1683_2723 | 346 |
| 130 | 3300042624 | Ga0466735_073812 | Ga0466735_073812_89_1129 | 346 |
| 131 | 3300042624 | Ga0466735_110970 | Ga0466735_110970_973_2013 | 346 |
| 132 | 3300042624 | Ga0466735_165517 | Ga0466735_165517_1462_2502 | 346 |
| 133 | 3300042624 | Ga0466735_170604 | Ga0466735_170604_25834_26874 | 346 |
| 134 | 3300042643 | Ga0466704_002412 | Ga0466704_002412_1082_2122 | 346 |
| 135 | 3300042648 | Ga0466709_180554 | Ga0466709_180554_37413_38453 | 346 |
| 136 | 3300042648 | Ga0466709_187563 | Ga0466709_187563_1488_2528 | 346 |
| 137 | 3300042652 | Ga0466708_004159 | Ga0466708_004159_935_1975 | 346 |
| 138 | 3300042655 | Ga0466727_003866 | Ga0466727_003866_142_1182 | 346 |
| 139 | 3300042655 | Ga0466727_006091 | Ga0466727_006091_1805_2845 | 346 |
| 140 | 3300042655 | Ga0466727_081347 | Ga0466727_081347_1689_2729 | 346 |
| 141 | 3300042659 | Ga0466733_049217 | Ga0466733_049217_1527_2567 | 346 |
| 142 | iso_pr_bacteria | 2820751898 | 2820752722 | 346 |
| 143 | 3300000062 | IMNBL1DRAFT_c0000189 | IMNBL1DRAFT_00001896 | 347 |
| 144 | 3300005201 | Ga0072941_1014146 | Ga0072941_10141462 | 347 |
| 145 | 3300010049 | Ga0123356_10021087 | Ga0123356_100210874 | 347 |
| 146 | 3300010882 | Ga0123354_10284923 | Ga0123354_102849232 | 347 |
| 147 | 3300042602 | Ga0466713_011249 | Ga0466713_011249_13823_14866 | 347 |
| 148 | 3300042606 | Ga0466719_182496 | Ga0466719_182496_624_1667 | 347 |
| 149 | 3300042609 | Ga0466722_241031 | Ga0466722_241031_2053_3096 | 347 |
| 150 | 3300042613 | Ga0466710_255028 | Ga0466710_255028_556_1599 | 347 |
| 151 | 3300042621 | Ga0466729_253159 | Ga0466729_253159_2152_3195 | 347 |
| 152 | 3300042636 | Ga0466703_413604 | Ga0466703_413604_2122_3165 | 347 |
| 153 | iso_pr_bacteria | 2788500057 | 2789390253 | 347 |
| 154 | iso_pr_bacteria | 2791354885 | 2791843903 | 347 |
| 155 | 3300000062 | IMNBL1DRAFT_c0018314 | IMNBL1DRAFT_00183142 | 348 |
| 156 | 3300010167 | Ga0123353_10365576 | Ga0123353_103655762 | 348 |
| 157 | 3300042602 | Ga0466713_061076 | Ga0466713_061076_12519_13565 | 348 |
| 158 | 3300005083 | Ga0068305_10036503 | Ga0068305_100365032 | 349 |
| 159 | 3300042606 | Ga0466719_397662 | Ga0466719_397662_1031_2080 | 349 |
| 160 | 3300042602 | Ga0466713_111867 | Ga0466713_111867_1744_2796 | 350 |
| 161 | 3300042602 | Ga0466713_089027 | Ga0466713_089027_956_2011 | 351 |
| 162 | 3300042593 | Ga0466691_051682 | Ga0466691_051682_396_1460 | 354 |
| 163 | 3300042602 | Ga0466713_094496 | Ga0466713_094496_1662_2726 | 354 |
| 164 | iso_pr_bacteria | 2967483437 | 2967487116 | 355 |
| 165 | 3300042619 | Ga0466726_012021 | Ga0466726_012021_16182_17252 | 356 |
| 166 | iso_pr_bacteria | 8065497608 | 8065501017 | 356 |
| 167 | 3300042605 | Ga0466716_169667 | Ga0466716_169667_4607_5722 | 371 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.9 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.