Protein Family IF06350

Metagenome Isolate
128 Members
44 Samples
124 Scaffolds
219.48 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_163467|Ga0466716_163467_5259_5918
Length
219 aa
Sequence
MDDRQWRFKLKKFGQIFVNGLVNENPLLILMIGLCSSLAVTTSVANGIGMGLSMTFVLLMSEFVISLFKKLIPSSVRIPIFIIVIAAFTTIIDYVLQAYFPALSKAMGVFIPLIVVNCIIMGRVEAFASKQPVIYSIADGLGMGLGYTWVLAGISLIRELLGNGSILDIPVFGENYQPVLFFTLPPGGFFVFSLFISLGLYIKQRQSKTPINRNKEGCC

📊 Sample Types

Isolate 3.1%
Metagenome 96.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Kalotermitidae 33.3%
Unclassified 14.3%
Rhinotermitidae 9.5%
Termopsidae 7.1%
Hodotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
2 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
5 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
6 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
30 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
31 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
34 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
35 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
36 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
37 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
40 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
41 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
42 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_233621 3300042612 Bacteria 5538
2 Ga0466735_233186 3300042624 Bacteria 2307
3 Ga0466709_096447 3300042648 Bacteria 5475
4 Ga0466726_108905 3300042619 Bacteria 3052
5 Ga0456237_0000677 3300041968 Bacteria 5199
6 Ga0466690_118448 3300042590 Bacteria 12927
7 Ga0466699_178489 3300042597 Bacteria 6874
8 Ga0466716_299395 3300042605 Bacteria 2677
9 Ga0466698_026555 3300042610 Bacteria 3352
10 JGI24698J34947_10039293 3300002449 Bacteria 2450
11 Ga0466705_343239 3300042612 Bacteria 6013
12 Ga0466733_149704 3300042659 Bacteria 1267
13 Ga0466704_063785 3300042643 Bacteria 6179
14 Ga0466704_111914 3300042643 Bacteria 32572
15 Ga0466727_009613 3300042655 Bacteria 3623
16 Ga0466727_328002 3300042655 Bacteria 1462
17 Ga0466712_213897 3300042614 Bacteria 3156
18 Ga0466715_046121 3300042616 Bacteria 12463
19 Ga0466718_157142 3300042617 Bacteria 8375
20 Ga0466723_271071 3300042618 Bacteria 28341
21 Ga0466723_358439 3300042618 Bacteria 6638
22 Ga0466728_103376 3300042620 Bacteria 5157
23 Ga0466690_064021 3300042590 Unclassified 2980
24 Ga0466690_344927 3300042590 Unclassified 1247
25 Ga0466696_311178 3300042596 Bacteria 4031
26 Ga0466717_237919 3300042604 Bacteria 1128
27 Ga0466717_294173 3300042604 Bacteria 1208
28 Ga0466719_094611 3300042606 Bacteria 13765
29 Ga0466719_230023 3300042606 Bacteria 5913
30 Ga0466722_069869 3300042609 Bacteria 16014
31 Ga0466722_125659 3300042609 Bacteria 5104
32 Ga0466698_351407 3300042610 Bacteria 1092
33 JGI24698J34947_10049605 3300002449 Unclassified 2120
34 JGI24702J35022_10054181 3300002462 Bacteria 2139
35 Ga0466731_209400 3300042622 Bacteria 7378
36 Ga0466703_170113 3300042636 Bacteria 2953
37 Ga0466715_273981 3300042616 Bacteria 60871
38 Ga0466718_003629 3300042617 Unclassified 4675
39 Ga0466718_024150 3300042617 Bacteria 5457
40 Ga0466723_090972 3300042618 Bacteria 10555
41 Ga0466726_305196 3300042619 Bacteria 2247
42 Ga0466729_062744 3300042621 Bacteria 2948
43 Ga0466690_243507 3300042590 Bacteria 6031
44 Ga0466716_163467 3300042605 Bacteria 8995
45 Ga0466722_233105 3300042609 Bacteria 4687
46 AustNasuHG_c1000870 3300000089 Bacteria 10879
47 JGI24698J34947_10041149 3300002449 Bacteria 2382
48 Ga0072940_1015598 3300005200 Bacteria 1044
49 Ga0466704_183878 3300042643 Bacteria 1534
50 Ga0466704_262422 3300042643 Bacteria 1875
51 Ga0466712_067079 3300042614 Bacteria 12562
52 Ga0466712_112287 3300042614 Bacteria 5731
53 Ga0466718_062257 3300042617 Bacteria 1651
54 Ga0466726_354722 3300042619 Bacteria 13701
55 Ga0466726_405544 3300042619 Bacteria 5443
56 Ga0466690_419611 3300042590 Bacteria 2047
57 Ga0466692_047409 3300042591 Bacteria 3006
58 JGI24698J34947_10031561 3300002449 Unclassified 2787
59 JGI24698J34947_10031599 3300002449 Unclassified 2785
60 Ga0072941_1009080 3300005201 Bacteria 2146
61 Ga0466735_110333 3300042624 Bacteria 1639
62 Ga0466711_029879 3300042615 Bacteria 23647
63 Ga0466711_177408 3300042615 Bacteria 16419
64 Ga0466715_144659 3300042616 Bacteria 15652
65 Ga0466715_289497 3300042616 Bacteria 3216
66 Ga0466723_005794 3300042618 Bacteria 5450
67 Ga0466726_405952 3300042619 Bacteria 1780
68 Ga0466694_296005 3300042594 Bacteria 1472
69 Ga0466706_036353 3300042599 Bacteria 1090
70 Ga0466706_172351 3300042599 Bacteria 5512
71 Ga0466707_252833 3300042601 Bacteria 1605
72 Ga0466716_347731 3300042605 Bacteria 9336
73 Ga0466720_135890 3300042607 Bacteria 17742
74 Ga0466698_429491 3300042610 Bacteria 1435
75 AustNasuHG_c1000367 3300000089 Bacteria 15638
76 Ga0072941_1004807 3300005201 Bacteria 12183
77 Ga0466705_013927 3300042612 Bacteria 15021
78 Ga0466705_112129 3300042612 Bacteria 4805
79 Ga0466705_227110 3300042612 Bacteria 9868
80 Ga0466703_135641 3300042636 Bacteria 4937
81 Ga0466704_171804 3300042643 Bacteria 7129
82 Ga0466708_082784 3300042652 Bacteria 24752
83 Ga0466715_032569 3300042616 Bacteria 9902
84 Ga0466690_231472 3300042590 Unclassified 2902
85 Ga0466691_051032 3300042593 Bacteria 8917
86 Ga0466696_050703 3300042596 Bacteria 49917
87 Ga0466719_217203 3300042606 Bacteria 9135
88 Ga0466720_071220 3300042607 Bacteria 7252
89 Ga0466722_169974 3300042609 Bacteria 1675
90 JGI24698J34947_10012219 3300002449 Bacteria 4709
91 Ga0466733_016158 3300042659 Bacteria 12298
92 Ga0466735_040647 3300042624 Unclassified 1417
93 Ga0466703_015673 3300042636 Bacteria 18639
94 Ga0466703_047165 3300042636 Bacteria 1178
95 Ga0466703_215658 3300042636 Bacteria 2956
96 Ga0466711_137705 3300042615 Bacteria 18389
97 Ga0466715_272887 3300042616 Bacteria 28734
98 Ga0466726_265474 3300042619 Bacteria 2293
99 Ga0466726_426428 3300042619 Bacteria 5212
100 Ga0466728_258797 3300042620 Bacteria 5080
101 Ga0264413_100076 3300024493 Bacteria 24181
102 Ga0466690_431755 3300042590 Bacteria 2443
103 Ga0466691_015239 3300042593 Bacteria 10240
104 Ga0466694_015175 3300042594 Bacteria 7200
105 Ga0466699_052800 3300042597 Bacteria 2312
106 Ga0466698_212002 3300042610 Bacteria 1501
107 JGI24699J35502_11126002 3300002509 Bacteria 3886
108 Ga0068305_10000457 3300005083 Bacteria 6835
109 Ga0068305_10279830 3300005083 Bacteria 1727
110 Ga0072941_1002419 3300005201 Bacteria 7687
111 Ga0466705_360502 3300042612 Bacteria 1521
112 Ga0466735_139685 3300042624 Bacteria 8576
113 Ga0466712_219812 3300042614 Unclassified 1240
114 Ga0466723_009468 3300042618 Unclassified 4338
115 Ga0466690_310822 3300042590 Bacteria 1457
116 Ga0466691_178771 3300042593 Bacteria 25640
117 Ga0466694_334901 3300042594 Bacteria 1406
118 Ga0466696_009028 3300042596 Bacteria 7460
119 Ga0466706_241452 3300042599 Bacteria 4436
120 Ga0466722_005338 3300042609 Bacteria 57258
121 JGI24698J34947_10018141 3300002449 Bacteria 3807
122 JGI24702J35022_10006728 3300002462 Bacteria 6626
123 Ga0072941_1003408 3300005201 Bacteria 36537
124 Ga0072941_1009078 3300005201 Bacteria 22637

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_344927 Ga0466690_344927_622_1191 173
2 3300042636 Ga0466703_047165 Ga0466703_047165_426_1058 184
3 3300042593 Ga0466691_015239 Ga0466691_015239_57_626 189
4 3300042606 Ga0466719_230023 Ga0466719_230023_1819_2388 189
5 3300042612 Ga0466705_360502 Ga0466705_360502_207_839 189
6 3300005083 Ga0068305_10000457 Ga0068305_100004575 190
7 3300042624 Ga0466735_139685 Ga0466735_139685_3492_4127 192
8 3300042599 Ga0466706_172351 Ga0466706_172351_877_1509 193
9 3300042648 Ga0466709_096447 Ga0466709_096447_1707_2369 193
10 3300042596 Ga0466696_009028 Ga0466696_009028_3176_3808 194
11 3300042624 Ga0466735_233186 Ga0466735_233186_688_1317 194
12 3300042643 Ga0466704_262422 Ga0466704_262422_99_731 195
13 3300042616 Ga0466715_272887 Ga0466715_272887_11151_11762 196
14 3300042615 Ga0466711_029879 Ga0466711_029879_14400_15029 197
15 3300042636 Ga0466703_215658 Ga0466703_215658_1078_1710 197
16 3300042596 Ga0466696_050703 Ga0466696_050703_45920_46516 198
17 3300042615 Ga0466711_137705 Ga0466711_137705_16941_17573 198
18 3300042620 Ga0466728_258797 Ga0466728_258797_1382_2014 198
19 3300042590 Ga0466690_231472 Ga0466690_231472_312_959 199
20 3300042624 Ga0466735_110333 Ga0466735_110333_732_1361 199
21 3300042618 Ga0466723_358439 Ga0466723_358439_3961_4608 200
22 3300042612 Ga0466705_112129 Ga0466705_112129_2606_3238 202
23 3300042590 Ga0466690_118448 Ga0466690_118448_2774_3385 203
24 3300042609 Ga0466722_069869 Ga0466722_069869_6994_7605 203
25 3300042618 Ga0466723_271071 Ga0466723_271071_10236_10847 203
26 3300042619 Ga0466726_265474 Ga0466726_265474_1058_1669 203
27 3300042619 Ga0466726_405952 Ga0466726_405952_257_889 203
28 3300041968 Ga0456237_0000677 Ga0456237_0000677_2794_3408 204
29 3300042591 Ga0466692_047409 Ga0466692_047409_1012_1626 204
30 3300042605 Ga0466716_299395 Ga0466716_299395_1124_1771 204
31 3300042619 Ga0466726_108905 Ga0466726_108905_166_780 204
32 3300042593 Ga0466691_051032 Ga0466691_051032_3729_4361 205
33 3300042593 Ga0466691_178771 Ga0466691_178771_12725_13348 207
34 3300042606 Ga0466719_217203 Ga0466719_217203_3186_3809 207
35 3300042616 Ga0466715_144659 Ga0466715_144659_11531_12154 207
36 3300042618 Ga0466723_090972 Ga0466723_090972_736_1359 207
37 3300042643 Ga0466704_063785 Ga0466704_063785_3160_3783 207
38 3300042643 Ga0466704_171804 Ga0466704_171804_5499_6122 207
39 3300042643 Ga0466704_183878 Ga0466704_183878_334_957 207
40 3300042599 Ga0466706_241452 Ga0466706_241452_656_1303 209
41 3300042601 Ga0466707_252833 Ga0466707_252833_789_1418 209
42 3300042612 Ga0466705_343239 Ga0466705_343239_224_853 209
43 3300042620 Ga0466728_103376 Ga0466728_103376_2337_2966 209
44 3300042624 Ga0466735_040647 Ga0466735_040647_156_785 209
45 iso_pr_bacteria 650716099 650880476 209
46 3300042590 Ga0466690_064021 Ga0466690_064021_1198_1830 210
47 3300042609 Ga0466722_005338 Ga0466722_005338_16767_17399 210
48 3300042609 Ga0466722_125659 Ga0466722_125659_4321_4953 210
49 3300042609 Ga0466722_169974 Ga0466722_169974_36_668 210
50 3300042618 Ga0466723_009468 Ga0466723_009468_1346_1978 210
51 3300042619 Ga0466726_305196 Ga0466726_305196_431_1090 210
52 3300042619 Ga0466726_354722 Ga0466726_354722_9263_9895 210
53 3300042619 Ga0466726_405544 Ga0466726_405544_1516_2148 210
54 3300042619 Ga0466726_426428 Ga0466726_426428_855_1487 210
55 3300042652 Ga0466708_082784 Ga0466708_082784_13541_14173 210
56 3300042655 Ga0466727_009613 Ga0466727_009613_2564_3196 210
57 3300005083 Ga0068305_10279830 Ga0068305_102798303 211
58 3300042655 Ga0466727_328002 Ga0466727_328002_329_985 213
59 3300042590 Ga0466690_431755 Ga0466690_431755_809_1468 214
60 3300042596 Ga0466696_311178 Ga0466696_311178_1740_2387 215
61 3300042590 Ga0466690_243507 Ga0466690_243507_3386_4036 216
62 3300042659 Ga0466733_016158 Ga0466733_016158_5795_6448 217
63 iso_pr_bacteria 2781125694 2781437341 217
64 3300002449 JGI24698J34947_10039293 JGI24698J34947_100392933 218
65 3300042599 Ga0466706_036353 Ga0466706_036353_295_951 218
66 3300042616 Ga0466715_289497 Ga0466715_289497_1877_2533 218
67 3300042605 Ga0466716_163467 Ga0466716_163467_5259_5918 219
68 3300042605 Ga0466716_347731 Ga0466716_347731_4619_5278 219
69 3300042606 Ga0466719_094611 Ga0466719_094611_9550_10209 219
70 3300042612 Ga0466705_233621 Ga0466705_233621_2473_3132 219
71 3300042636 Ga0466703_170113 Ga0466703_170113_1078_1737 219
72 3300042616 Ga0466715_046121 Ga0466715_046121_8138_8806 222
73 3300042636 Ga0466703_135641 Ga0466703_135641_2666_3337 223
74 3300042643 Ga0466704_111914 Ga0466704_111914_16867_17538 223
75 3300042590 Ga0466690_310822 Ga0466690_310822_546_1313 225
76 3300042618 Ga0466723_005794 Ga0466723_005794_1454_2233 225
77 3300024493 Ga0264413_100076 Ga0264413_10007613 226
78 3300042594 Ga0466694_015175 Ga0466694_015175_3049_3729 226
79 3300042610 Ga0466698_026555 Ga0466698_026555_71_796 226
80 3300042621 Ga0466729_062744 Ga0466729_062744_1055_1735 226
81 3300042609 Ga0466722_233105 Ga0466722_233105_1351_2115 227
82 3300005201 Ga0072941_1009078 Ga0072941_100907823 228
83 3300005201 Ga0072941_1009080 Ga0072941_10090802 228
84 3300042610 Ga0466698_351407 Ga0466698_351407_300_1031 228
85 3300042614 Ga0466712_112287 Ga0466712_112287_3036_3722 228
86 3300002449 JGI24698J34947_10031561 JGI24698J34947_100315613 229
87 3300002462 JGI24702J35022_10006728 JGI24702J35022_100067284 229
88 3300002449 JGI24698J34947_10049605 JGI24698J34947_100496052 230
89 3300002509 JGI24699J35502_11126002 JGI24699J35502_111260023 230
90 3300042617 Ga0466718_062257 Ga0466718_062257_640_1332 230
91 3300042597 Ga0466699_052800 Ga0466699_052800_184_885 233
92 3300042610 Ga0466698_212002 Ga0466698_212002_181_882 233
93 3300042614 Ga0466712_067079 Ga0466712_067079_2009_2710 233
94 3300002449 JGI24698J34947_10031599 JGI24698J34947_100315992 234
95 3300005201 Ga0072941_1003408 Ga0072941_100340817 234
96 3300042614 Ga0466712_219812 Ga0466712_219812_526_1230 234
97 3300000089 AustNasuHG_c1000870 AustNasuHG_100087011 235
98 3300002449 JGI24698J34947_10012219 JGI24698J34947_100122194 235
99 3300042607 Ga0466720_135890 Ga0466720_135890_8749_9456 235
100 3300042615 Ga0466711_177408 Ga0466711_177408_12390_13166 235
101 3300042636 Ga0466703_015673 Ga0466703_015673_15136_15846 236
102 3300042590 Ga0466690_419611 Ga0466690_419611_759_1520 238
103 3300042607 Ga0466720_071220 Ga0466720_071220_5467_6183 238
104 3300042617 Ga0466718_157142 Ga0466718_157142_7232_7966 238
105 3300042594 Ga0466694_296005 Ga0466694_296005_543_1262 239
106 3300042612 Ga0466705_013927 Ga0466705_013927_3004_3786 239
107 3300042622 Ga0466731_209400 Ga0466731_209400_2941_3660 239
108 3300042597 Ga0466699_178489 Ga0466699_178489_3794_4516 240
109 3300002449 JGI24698J34947_10041149 JGI24698J34947_100411492 242
110 3300042610 Ga0466698_429491 Ga0466698_429491_194_922 242
111 3300005201 Ga0072941_1002419 Ga0072941_10024193 243
112 3300042612 Ga0466705_227110 Ga0466705_227110_3821_4573 244
113 3300042617 Ga0466718_003629 Ga0466718_003629_3162_3896 244
114 3300042617 Ga0466718_024150 Ga0466718_024150_1339_2073 244
115 3300042604 Ga0466717_294173 Ga0466717_294173_407_1144 245
116 3300042616 Ga0466715_273981 Ga0466715_273981_13729_14466 245
117 3300005200 Ga0072940_1015598 Ga0072940_10155982 246
118 3300042594 Ga0466694_334901 Ga0466694_334901_151_891 246
119 3300042604 Ga0466717_237919 Ga0466717_237919_15_755 246
120 3300005201 Ga0072941_1004807 Ga0072941_10048072 249
121 3300042614 Ga0466712_213897 Ga0466712_213897_696_1445 249
122 3300002449 JGI24698J34947_10018141 JGI24698J34947_100181413 251
123 3300000089 AustNasuHG_c1000367 AustNasuHG_10003674 252
124 iso_pr_bacteria 2781125629 2781264317 253
125 iso_pr_bacteria 2781125630 2781266265 253
126 3300042659 Ga0466733_149704 Ga0466733_149704_94_867 257
127 3300002462 JGI24702J35022_10054181 JGI24702J35022_100541812 258
128 3300042616 Ga0466715_032569 Ga0466715_032569_829_1635 268

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02508 Rnf-Nqr Rnf-Nqr subunit, membrane protein 15 195 0.99

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02508 GO:0016020 membrane CC

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.