Protein Family IF06340
Metagenome
Isolate
125
Members
37
Samples
123
Scaffolds
112.86
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_123974|Ga0466716_123974_1977_2360
- Length
- 127 aa
- Sequence
- MTESDLRIMLGINLKRFRTVMGFSQAKLAELLDLSPNFVSELETGKRWLSSDTLTNLAGILGVEVYEFFKPEAIPQEDPEIIENLIKKYTGKAVIAAAAAVTETLNDLCRQYCSKQGPASPGAEEGE
Sample Types
Isolate
1.6%
Metagenome
98.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Kalotermitidae
25.7%
Unclassified
11.4%
Rhinotermitidae
8.6%
Termopsidae
8.6%
Taxonomy
Archaea
0
Bacteria
109
Eukaryota
0
Viruses
1
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 2 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 3 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 4 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 5 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 9 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 12 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_143501 | 3300042614 | Bacteria | 35439 |
| 2 | Ga0466726_405653 | 3300042619 | Bacteria | 1500 |
| 3 | Ga0466719_365468 | 3300042606 | Bacteria | 2123 |
| 4 | Ga0123356_13559809 | 3300010049 | Unclassified | 539 |
| 5 | AustNasuHG_c1068037 | 3300000089 | Bacteria | 654 |
| 6 | JGI24698J34947_10011982 | 3300002449 | Bacteria | 4761 |
| 7 | JGI24698J34947_10091707 | 3300002449 | Bacteria | 1392 |
| 8 | Ga0466732_070552 | 3300042656 | Bacteria | 1085 |
| 9 | Ga0466712_084394 | 3300042614 | Bacteria | 4855 |
| 10 | Ga0466718_053496 | 3300042617 | Unclassified | 1250 |
| 11 | Ga0466729_307771 | 3300042621 | Bacteria | 1180 |
| 12 | Ga0466735_027661 | 3300042624 | Bacteria | 7559 |
| 13 | Ga0466709_350925 | 3300042648 | Bacteria | 5126 |
| 14 | Ga0466727_190899 | 3300042655 | Bacteria | 4547 |
| 15 | Ga0466707_188625 | 3300042601 | Bacteria | 1669 |
| 16 | Ga0466698_292268 | 3300042610 | Bacteria | 1310 |
| 17 | Ga0466694_290729 | 3300042594 | Unclassified | 1371 |
| 18 | JGI24698J34947_10018068 | 3300002449 | Bacteria | 3816 |
| 19 | JGI24698J34947_10089093 | 3300002449 | Bacteria | 1422 |
| 20 | JGI24698J34947_10278257 | 3300002449 | Bacteria | 613 |
| 21 | Ga0466705_330393 | 3300042612 | Bacteria | 1672 |
| 22 | Ga0466732_119417 | 3300042656 | Bacteria | 5754 |
| 23 | Ga0466732_425103 | 3300042656 | Unclassified | 1439 |
| 24 | Ga0466712_002161 | 3300042614 | Bacteria | 3435 |
| 25 | Ga0466723_199432 | 3300042618 | Bacteria | 5583 |
| 26 | Ga0466726_157809 | 3300042619 | Bacteria | 1271 |
| 27 | Ga0466726_255421 | 3300042619 | Bacteria | 1538 |
| 28 | Ga0466735_005332 | 3300042624 | Bacteria | 10974 |
| 29 | Ga0466727_070577 | 3300042655 | Bacteria | 10459 |
| 30 | Ga0466707_400121 | 3300042601 | Bacteria | 1453 |
| 31 | Ga0466716_123974 | 3300042605 | Bacteria | 4941 |
| 32 | Ga0466719_230243 | 3300042606 | Bacteria | 2637 |
| 33 | Ga0466719_540145 | 3300042606 | Bacteria | 1128 |
| 34 | Ga0264413_102446 | 3300024493 | Bacteria | 20256 |
| 35 | Ga0466693_202889 | 3300042592 | Bacteria | 1296 |
| 36 | Ga0466699_286124 | 3300042597 | Viruses | 3299 |
| 37 | Ga0466699_333806 | 3300042597 | Bacteria | 1098 |
| 38 | Ga0072941_1008255 | 3300005201 | Bacteria | 10283 |
| 39 | Ga0072941_1103668 | 3300005201 | Bacteria | 4869 |
| 40 | Ga0466726_093964 | 3300042619 | Bacteria | 4993 |
| 41 | Ga0466726_236006 | 3300042619 | Bacteria | 1192 |
| 42 | Ga0466726_257185 | 3300042619 | Unclassified | 1306 |
| 43 | Ga0466726_481989 | 3300042619 | Bacteria | 1669 |
| 44 | Ga0466704_326167 | 3300042643 | Bacteria | 3286 |
| 45 | Ga0466704_433683 | 3300042643 | Bacteria | 1716 |
| 46 | Ga0466727_238303 | 3300042655 | Bacteria | 3772 |
| 47 | Ga0466713_155096 | 3300042602 | Bacteria | 1772 |
| 48 | Ga0466717_059089 | 3300042604 | Unclassified | 1227 |
| 49 | Ga0466690_235338 | 3300042590 | Bacteria | 5484 |
| 50 | Ga0466692_004508 | 3300042591 | Bacteria | 3400 |
| 51 | Ga0466692_130589 | 3300042591 | Bacteria | 3988 |
| 52 | Ga0466692_172302 | 3300042591 | Bacteria | 1607 |
| 53 | Ga0466694_033793 | 3300042594 | Bacteria | 3932 |
| 54 | Ga0466699_073116 | 3300042597 | Bacteria | 4277 |
| 55 | AustNasuHG_c1000443 | 3300000089 | Bacteria | 14516 |
| 56 | JGI24698J34947_10098872 | 3300002449 | Bacteria | 1317 |
| 57 | Ga0072940_1001965 | 3300005200 | Bacteria | 5723 |
| 58 | Ga0072941_1029192 | 3300005201 | Bacteria | 2148 |
| 59 | Ga0072941_1136482 | 3300005201 | Bacteria | 1084 |
| 60 | Ga0466712_158334 | 3300042614 | Bacteria | 1407 |
| 61 | Ga0466726_076564 | 3300042619 | Unclassified | 1069 |
| 62 | Ga0466726_366783 | 3300042619 | Bacteria | 27666 |
| 63 | Ga0466727_003283 | 3300042655 | Bacteria | 1584 |
| 64 | Ga0466713_010592 | 3300042602 | Bacteria | 6005 |
| 65 | Ga0466690_117591 | 3300042590 | Bacteria | 2646 |
| 66 | Ga0466692_034311 | 3300042591 | Bacteria | 2088 |
| 67 | Ga0466699_134571 | 3300042597 | Unclassified | 1610 |
| 68 | Ga0123356_10514232 | 3300010049 | Unclassified | 1355 |
| 69 | JGI24698J34947_10020639 | 3300002449 | Bacteria | 3546 |
| 70 | Ga0072941_1024810 | 3300005201 | Bacteria | 3639 |
| 71 | Ga0072941_1024811 | 3300005201 | Bacteria | 6318 |
| 72 | Ga0466732_156304 | 3300042656 | Unclassified | 2401 |
| 73 | Ga0466712_054379 | 3300042614 | Bacteria | 13274 |
| 74 | Ga0466718_016457 | 3300042617 | Bacteria | 1061 |
| 75 | Ga0466718_032167 | 3300042617 | Bacteria | 3839 |
| 76 | Ga0466726_054451 | 3300042619 | Bacteria | 1674 |
| 77 | Ga0466702_453367 | 3300042635 | Unclassified | 1242 |
| 78 | Ga0466704_019469 | 3300042643 | Bacteria | 5209 |
| 79 | Ga0466727_130676 | 3300042655 | Bacteria | 1049 |
| 80 | Ga0466707_275266 | 3300042601 | Bacteria | 2615 |
| 81 | Ga0466707_315805 | 3300042601 | Bacteria | 1799 |
| 82 | Ga0466722_178290 | 3300042609 | Bacteria | 1414 |
| 83 | Ga0466692_182117 | 3300042591 | Bacteria | 2746 |
| 84 | Ga0466699_019237 | 3300042597 | Bacteria | 4423 |
| 85 | Ga0466699_251807 | 3300042597 | Bacteria | 1272 |
| 86 | Ga0123356_10107923 | 3300010049 | Bacteria | 2683 |
| 87 | Ga0123356_12694308 | 3300010049 | Bacteria | 622 |
| 88 | AustNasuHG_c1000834 | 3300000089 | Bacteria | 11069 |
| 89 | AustNasuHG_c1084943 | 3300000089 | Bacteria | 524 |
| 90 | JGI24698J34947_10007440 | 3300002449 | Bacteria | 6020 |
| 91 | JGI24698J34947_10156378 | 3300002449 | Unclassified | 939 |
| 92 | JGI24695J34938_10000052 | 3300002450 | Bacteria | 90676 |
| 93 | Ga0072941_1107953 | 3300005201 | Bacteria | 561 |
| 94 | Ga0466712_188128 | 3300042614 | Bacteria | 4665 |
| 95 | Ga0466726_141625 | 3300042619 | Bacteria | 7453 |
| 96 | Ga0466702_335595 | 3300042635 | Bacteria | 1174 |
| 97 | Ga0466704_559155 | 3300042643 | Bacteria | 3558 |
| 98 | Ga0466707_132723 | 3300042601 | Bacteria | 2170 |
| 99 | Ga0466721_376648 | 3300042608 | Bacteria | 1487 |
| 100 | Ga0466691_065583 | 3300042593 | Bacteria | 6963 |
| 101 | Ga0123356_12788114 | 3300010049 | Bacteria | 612 |
| 102 | AustNasuHG_c1021074 | 3300000089 | Bacteria | 2115 |
| 103 | JGI24698J34947_10015399 | 3300002449 | Bacteria | 4164 |
| 104 | JGI24698J34947_10024068 | 3300002449 | Unclassified | 3254 |
| 105 | JGI24695J34938_10252093 | 3300002450 | Bacteria | 749 |
| 106 | Ga0466735_033006 | 3300042624 | Bacteria | 14657 |
| 107 | Ga0466735_099809 | 3300042624 | Bacteria | 9237 |
| 108 | Ga0466708_173180 | 3300042652 | Bacteria | 4698 |
| 109 | Ga0466727_026956 | 3300042655 | Bacteria | 1258 |
| 110 | Ga0466727_052356 | 3300042655 | Bacteria | 1453 |
| 111 | Ga0466707_007066 | 3300042601 | Bacteria | 1429 |
| 112 | Ga0466707_407491 | 3300042601 | Bacteria | 3908 |
| 113 | Ga0466720_124928 | 3300042607 | Bacteria | 2924 |
| 114 | Ga0466690_045176 | 3300042590 | Bacteria | 1393 |
| 115 | Ga0466692_030650 | 3300042591 | Unclassified | 1536 |
| 116 | Ga0466692_106268 | 3300042591 | Bacteria | 1012 |
| 117 | Ga0466694_114435 | 3300042594 | Bacteria | 2426 |
| 118 | Ga0123356_10207305 | 3300010049 | Bacteria | 2005 |
| 119 | Ga0123356_12455494 | 3300010049 | Bacteria | 652 |
| 120 | JGI24695J34938_10001279 | 3300002450 | Bacteria | 22067 |
| 121 | Ga0072940_1034055 | 3300005200 | Bacteria | 2674 |
| 122 | Ga0072940_1034056 | 3300005200 | Bacteria | 805 |
| 123 | Ga0072940_1034057 | 3300005200 | Unclassified | 6656 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042619 | Ga0466726_093964 | Ga0466726_093964_4167_4505 | 98 |
| 2 | 3300024493 | Ga0264413_102446 | Ga0264413_1024462 | 99 |
| 3 | 3300042619 | Ga0466726_257185 | Ga0466726_257185_645_983 | 100 |
| 4 | 3300042619 | Ga0466726_141625 | Ga0466726_141625_2299_2637 | 101 |
| 5 | 3300042655 | Ga0466727_026956 | Ga0466727_026956_179_517 | 101 |
| 6 | 3300042655 | Ga0466727_130676 | Ga0466727_130676_647_985 | 102 |
| 7 | 3300042591 | Ga0466692_106268 | Ga0466692_106268_295_618 | 107 |
| 8 | 3300042591 | Ga0466692_172302 | Ga0466692_172302_306_629 | 107 |
| 9 | 3300042624 | Ga0466735_033006 | Ga0466735_033006_11446_11775 | 109 |
| 10 | 3300042592 | Ga0466693_202889 | Ga0466693_202889_281_613 | 110 |
| 11 | 3300042643 | Ga0466704_326167 | Ga0466704_326167_1283_1615 | 110 |
| 12 | iso_pr_bacteria | 2781125646 | 2781300685 | 110 |
| 13 | 3300000089 | AustNasuHG_c1000443 | AustNasuHG_100044312 | 111 |
| 14 | 3300002450 | JGI24695J34938_10000052 | JGI24695J34938_100000528 | 111 |
| 15 | 3300005200 | Ga0072940_1034057 | Ga0072940_10340577 | 111 |
| 16 | 3300005201 | Ga0072941_1024811 | Ga0072941_10248112 | 111 |
| 17 | 3300042590 | Ga0466690_045176 | Ga0466690_045176_649_984 | 111 |
| 18 | 3300042590 | Ga0466690_117591 | Ga0466690_117591_1322_1657 | 111 |
| 19 | 3300042591 | Ga0466692_004508 | Ga0466692_004508_2353_2688 | 111 |
| 20 | 3300042591 | Ga0466692_034311 | Ga0466692_034311_783_1118 | 111 |
| 21 | 3300042591 | Ga0466692_182117 | Ga0466692_182117_987_1322 | 111 |
| 22 | 3300042593 | Ga0466691_065583 | Ga0466691_065583_181_516 | 111 |
| 23 | 3300042594 | Ga0466694_290729 | Ga0466694_290729_932_1267 | 111 |
| 24 | 3300042597 | Ga0466699_019237 | Ga0466699_019237_3027_3362 | 111 |
| 25 | 3300042597 | Ga0466699_134571 | Ga0466699_134571_145_480 | 111 |
| 26 | 3300042597 | Ga0466699_286124 | Ga0466699_286124_2251_2586 | 111 |
| 27 | 3300042597 | Ga0466699_333806 | Ga0466699_333806_318_653 | 111 |
| 28 | 3300042606 | Ga0466719_230243 | Ga0466719_230243_1716_2051 | 111 |
| 29 | 3300042606 | Ga0466719_365468 | Ga0466719_365468_1128_1463 | 111 |
| 30 | 3300042609 | Ga0466722_178290 | Ga0466722_178290_678_1013 | 111 |
| 31 | 3300042612 | Ga0466705_330393 | Ga0466705_330393_10_345 | 111 |
| 32 | 3300042617 | Ga0466718_032167 | Ga0466718_032167_3114_3449 | 111 |
| 33 | 3300042617 | Ga0466718_053496 | Ga0466718_053496_642_977 | 111 |
| 34 | 3300042618 | Ga0466723_199432 | Ga0466723_199432_2922_3257 | 111 |
| 35 | 3300042619 | Ga0466726_405653 | Ga0466726_405653_290_625 | 111 |
| 36 | 3300042635 | Ga0466702_335595 | Ga0466702_335595_212_547 | 111 |
| 37 | 3300042635 | Ga0466702_453367 | Ga0466702_453367_259_594 | 111 |
| 38 | 3300042643 | Ga0466704_019469 | Ga0466704_019469_4403_4738 | 111 |
| 39 | 3300042643 | Ga0466704_433683 | Ga0466704_433683_1036_1371 | 111 |
| 40 | 3300042643 | Ga0466704_559155 | Ga0466704_559155_519_854 | 111 |
| 41 | 3300042656 | Ga0466732_070552 | Ga0466732_070552_538_873 | 111 |
| 42 | 3300042656 | Ga0466732_119417 | Ga0466732_119417_5270_5605 | 111 |
| 43 | 3300042656 | Ga0466732_156304 | Ga0466732_156304_1931_2266 | 111 |
| 44 | 3300042656 | Ga0466732_425103 | Ga0466732_425103_82_417 | 111 |
| 45 | 3300000089 | AustNasuHG_c1000834 | AustNasuHG_10008345 | 112 |
| 46 | 3300000089 | AustNasuHG_c1021074 | AustNasuHG_10210743 | 112 |
| 47 | 3300000089 | AustNasuHG_c1068037 | AustNasuHG_10680372 | 112 |
| 48 | 3300002449 | JGI24698J34947_10007440 | JGI24698J34947_100074402 | 112 |
| 49 | 3300002449 | JGI24698J34947_10011982 | JGI24698J34947_100119824 | 112 |
| 50 | 3300002449 | JGI24698J34947_10020639 | JGI24698J34947_100206393 | 112 |
| 51 | 3300002449 | JGI24698J34947_10098872 | JGI24698J34947_100988722 | 112 |
| 52 | 3300002450 | JGI24695J34938_10001279 | JGI24695J34938_1000127924 | 112 |
| 53 | 3300002450 | JGI24695J34938_10252093 | JGI24695J34938_102520932 | 112 |
| 54 | 3300005200 | Ga0072940_1001965 | Ga0072940_10019651 | 112 |
| 55 | 3300005200 | Ga0072940_1034055 | Ga0072940_10340554 | 112 |
| 56 | 3300005200 | Ga0072940_1034056 | Ga0072940_10340562 | 112 |
| 57 | 3300005201 | Ga0072941_1029192 | Ga0072941_10291921 | 112 |
| 58 | 3300005201 | Ga0072941_1103668 | Ga0072941_11036684 | 112 |
| 59 | 3300010049 | Ga0123356_10207305 | Ga0123356_102073052 | 112 |
| 60 | 3300010049 | Ga0123356_10514232 | Ga0123356_105142321 | 112 |
| 61 | 3300010049 | Ga0123356_12455494 | Ga0123356_124554942 | 112 |
| 62 | 3300010049 | Ga0123356_12694308 | Ga0123356_126943082 | 112 |
| 63 | 3300010049 | Ga0123356_13559809 | Ga0123356_135598091 | 112 |
| 64 | 3300042590 | Ga0466690_235338 | Ga0466690_235338_2367_2705 | 112 |
| 65 | 3300042601 | Ga0466707_007066 | Ga0466707_007066_619_957 | 112 |
| 66 | 3300042601 | Ga0466707_132723 | Ga0466707_132723_1586_1924 | 112 |
| 67 | 3300042601 | Ga0466707_188625 | Ga0466707_188625_385_723 | 112 |
| 68 | 3300042601 | Ga0466707_275266 | Ga0466707_275266_89_427 | 112 |
| 69 | 3300042601 | Ga0466707_315805 | Ga0466707_315805_109_447 | 112 |
| 70 | 3300042601 | Ga0466707_400121 | Ga0466707_400121_959_1297 | 112 |
| 71 | 3300042601 | Ga0466707_407491 | Ga0466707_407491_111_449 | 112 |
| 72 | 3300042602 | Ga0466713_155096 | Ga0466713_155096_335_673 | 112 |
| 73 | 3300042614 | Ga0466712_002161 | Ga0466712_002161_297_635 | 112 |
| 74 | 3300042614 | Ga0466712_188128 | Ga0466712_188128_565_903 | 112 |
| 75 | 3300042619 | Ga0466726_054451 | Ga0466726_054451_869_1207 | 112 |
| 76 | 3300042619 | Ga0466726_076564 | Ga0466726_076564_657_995 | 112 |
| 77 | 3300042619 | Ga0466726_236006 | Ga0466726_236006_355_693 | 112 |
| 78 | 3300042619 | Ga0466726_255421 | Ga0466726_255421_545_883 | 112 |
| 79 | 3300042624 | Ga0466735_005332 | Ga0466735_005332_9471_9809 | 112 |
| 80 | 3300042624 | Ga0466735_027661 | Ga0466735_027661_6606_6944 | 112 |
| 81 | 3300042624 | Ga0466735_099809 | Ga0466735_099809_5644_5982 | 112 |
| 82 | 3300042652 | Ga0466708_173180 | Ga0466708_173180_1447_1785 | 112 |
| 83 | 3300042655 | Ga0466727_190899 | Ga0466727_190899_849_1187 | 112 |
| 84 | 3300005201 | Ga0072941_1107953 | Ga0072941_11079531 | 113 |
| 85 | 3300042619 | Ga0466726_157809 | Ga0466726_157809_379_720 | 113 |
| 86 | 3300042621 | Ga0466729_307771 | Ga0466729_307771_705_1046 | 113 |
| 87 | 3300042655 | Ga0466727_003283 | Ga0466727_003283_1170_1511 | 113 |
| 88 | 3300005201 | Ga0072941_1024810 | Ga0072941_10248103 | 114 |
| 89 | 3300042591 | Ga0466692_030650 | Ga0466692_030650_982_1326 | 114 |
| 90 | 3300042597 | Ga0466699_073116 | Ga0466699_073116_3752_4096 | 114 |
| 91 | 3300042597 | Ga0466699_251807 | Ga0466699_251807_173_517 | 114 |
| 92 | 3300042604 | Ga0466717_059089 | Ga0466717_059089_160_504 | 114 |
| 93 | 3300042608 | Ga0466721_376648 | Ga0466721_376648_319_663 | 114 |
| 94 | 3300042614 | Ga0466712_158334 | Ga0466712_158334_514_858 | 114 |
| 95 | 3300042619 | Ga0466726_366783 | Ga0466726_366783_1575_1919 | 114 |
| 96 | 3300042619 | Ga0466726_481989 | Ga0466726_481989_1182_1526 | 114 |
| 97 | 3300042655 | Ga0466727_070577 | Ga0466727_070577_6323_6667 | 114 |
| 98 | 3300002449 | JGI24698J34947_10156378 | JGI24698J34947_101563782 | 115 |
| 99 | 3300010049 | Ga0123356_10107923 | Ga0123356_101079232 | 115 |
| 100 | 3300010049 | Ga0123356_12788114 | Ga0123356_127881141 | 115 |
| 101 | 3300042594 | Ga0466694_033793 | Ga0466694_033793_1588_1935 | 115 |
| 102 | 3300042594 | Ga0466694_114435 | Ga0466694_114435_126_473 | 115 |
| 103 | 3300042655 | Ga0466727_052356 | Ga0466727_052356_333_680 | 115 |
| 104 | 3300042655 | Ga0466727_238303 | Ga0466727_238303_1344_1691 | 115 |
| 105 | 3300005201 | Ga0072941_1008255 | Ga0072941_100825510 | 116 |
| 106 | 3300042606 | Ga0466719_540145 | Ga0466719_540145_408_758 | 116 |
| 107 | 3300042617 | Ga0466718_016457 | Ga0466718_016457_332_682 | 116 |
| 108 | iso_pr_bacteria | 2781125694 | 2781437202 | 117 |
| 109 | 3300002449 | JGI24698J34947_10018068 | JGI24698J34947_100180688 | 119 |
| 110 | 3300002449 | JGI24698J34947_10089093 | JGI24698J34947_100890931 | 119 |
| 111 | 3300042607 | Ga0466720_124928 | Ga0466720_124928_965_1324 | 119 |
| 112 | 3300042610 | Ga0466698_292268 | Ga0466698_292268_883_1242 | 119 |
| 113 | 3300000089 | AustNasuHG_c1084943 | AustNasuHG_10849432 | 120 |
| 114 | 3300005201 | Ga0072941_1136482 | Ga0072941_11364821 | 120 |
| 115 | 3300042614 | Ga0466712_054379 | Ga0466712_054379_9774_10139 | 121 |
| 116 | 3300042614 | Ga0466712_084394 | Ga0466712_084394_838_1203 | 121 |
| 117 | 3300002449 | JGI24698J34947_10278257 | JGI24698J34947_102782572 | 122 |
| 118 | 3300042614 | Ga0466712_143501 | Ga0466712_143501_4826_5194 | 122 |
| 119 | 3300002449 | JGI24698J34947_10015399 | JGI24698J34947_100153992 | 123 |
| 120 | 3300002449 | JGI24698J34947_10024068 | JGI24698J34947_100240681 | 123 |
| 121 | 3300002449 | JGI24698J34947_10091707 | JGI24698J34947_100917071 | 123 |
| 122 | 3300042602 | Ga0466713_010592 | Ga0466713_010592_4950_5321 | 123 |
| 123 | 3300042591 | Ga0466692_130589 | Ga0466692_130589_1289_1663 | 124 |
| 124 | 3300042648 | Ga0466709_350925 | Ga0466709_350925_528_908 | 126 |
| 125 | 3300042605 | Ga0466716_123974 | Ga0466716_123974_1977_2360 | 127 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.57 | 0.69 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.