Protein Family IF06334

Metagenome Isolate
204 Members
68 Samples
192 Scaffolds
338.5 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_116636|Ga0466716_116636_1557_2570
Length
337 aa
Sequence
MEETNKGEIVIYRREDRDIRVHVRLEDGSVWLTQAQLVELYRSSKASVSEHIRHIFDEGEIQEDSVVRKIRTTAADGKSYEVAHYNLDLIIALGYRIKSPVATQFRIWATGRLREYVVKGFTMDDERLKNVGGGDYWHELLNRIRDIRSSEKVLYRQVLDLYATSIDYDPQSTVSVEFFKVVQNKLHYAAHGHTAAEVIYERADSNQPFMGLTVFSGDHPTLRDVAVAKNYLTEEELKVLNNLVSGYFDFAEIQAMRHKPMYMEDYVRQLDNILSSTGESVLKNAGTVSHTQALEKAKAEYKKYQVKTLSAVEQHYLETVKDVQKKISGKSRKPHNS

📊 Sample Types

Isolate 5.9%
Metagenome 94.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.5%
Kalotermitidae 20.0%
Unclassified 18.5%
Rhinotermitidae 6.2%
Passalidae 4.6%
Termopsidae 4.6%
Blaberidae 1.5%
Hodotermitidae 1.5%
Blattidae 1.5%

🌳 Taxonomy

Archaea 4
Bacteria 191
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2772190975 Treponema sp. RmG30 Isolate Blaberidae
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
25 2820634724 Unclassified Firmicutes Emb289P1bin116 Isolate Unclassified
26 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
33 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
34 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
35 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
36 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
43 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
44 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
45 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
46 2820558799 Unclassified Firmicutes Emb289P3bin74 Isolate Unclassified
47 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
48 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
49 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
52 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
55 2820946191 Unclassified Acidobacteria Nt197P3bin31 Isolate Unclassified
56 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
57 2820671341 Unclassified Firmicutes Co191P3bin20 Isolate Unclassified
58 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
59 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
60 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
61 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
62 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
63 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
64 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
65 2820711732 Unclassified Firmicutes Co191P1bin26 Isolate Unclassified
66 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
67 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
68 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_129799 3300042612 Bacteria 3582
2 Ga0466733_188132 3300042659 Bacteria 1898
3 Ga0123357_10345239 3300009784 Bacteria 1433
4 Ga0123354_10247535 3300010882 Bacteria 1815
5 Ga0466706_166865 3300042599 Unclassified 14407
6 Ga0466706_255820 3300042599 Bacteria 4931
7 Ga0466707_109335 3300042601 Bacteria 18895
8 Ga0466707_286606 3300042601 Bacteria 1219
9 Ga0466717_231829 3300042604 Bacteria 1996
10 Ga0466716_116636 3300042605 Bacteria 3741
11 Ga0466716_358018 3300042605 Bacteria 2088
12 Ga0466721_212023 3300042608 Bacteria 1189
13 2226985944 2225789003 Bacteria 7911
14 2227323852 2225789004 Bacteria 1184
15 Ga0466696_290099 3300042596 Unclassified 1272
16 Ga0466727_104488 3300042655 Archaea 1435
17 Ga0466727_191999 3300042655 Bacteria 1853
18 Ga0466711_515405 3300042615 Bacteria 2959
19 Ga0466723_218913 3300042618 Bacteria 18660
20 Ga0466729_128850 3300042621 Bacteria 1479
21 Ga0466733_095137 3300042659 Bacteria 1634
22 Ga0466733_115480 3300042659 Bacteria 1507
23 Ga0123356_10436761 3300010049 Bacteria 1454
24 Ga0123353_10003004 3300010167 Bacteria 21125
25 Ga0123353_10291110 3300010167 Bacteria 2500
26 Ga0123353_10775388 3300010167 Bacteria 1329
27 Ga0466706_179014 3300042599 Bacteria 61419
28 Ga0466707_119591 3300042601 Bacteria 1879
29 Ga0466707_309971 3300042601 Bacteria 2445
30 Ga0466713_123884 3300042602 Bacteria 1898
31 2227501582 2225789004 Bacteria 3788
32 IMNBL1DRAFT_c0000045 3300000062 Bacteria 114518
33 IMNBL1DRAFT_c0000444 3300000062 Bacteria 34756
34 JGI24702J35022_10004305 3300002462 Bacteria 8488
35 Ga0466690_041758 3300042590 Bacteria 2121
36 Ga0466696_113521 3300042596 Bacteria 41827
37 Ga0466731_128444 3300042622 Bacteria 4462
38 Ga0466731_272421 3300042622 Bacteria 1449
39 Ga0466703_197231 3300042636 Bacteria 13264
40 Ga0466703_203043 3300042636 Bacteria 6127
41 Ga0466704_148028 3300042643 Unclassified 11572
42 Ga0466725_380346 3300042654 Bacteria 2974
43 Ga0466727_173493 3300042655 Bacteria 18839
44 Ga0466705_437875 3300042612 Bacteria 1486
45 Ga0466711_025258 3300042615 Bacteria 45468
46 Ga0466711_067304 3300042615 Bacteria 1250
47 Ga0466711_069341 3300042615 Bacteria 69315
48 Ga0466711_122715 3300042615 Bacteria 7108
49 Ga0466711_266206 3300042615 Bacteria 3860
50 Ga0466726_084081 3300042619 Bacteria 6458
51 Ga0466726_089937 3300042619 Bacteria 1262
52 Ga0466728_065585 3300042620 Bacteria 1096
53 Ga0466729_047133 3300042621 Bacteria 9467
54 Ga0466705_004115 3300042612 Bacteria 7494
55 Ga0466733_033499 3300042659 Bacteria 15025
56 Ga0123353_10000745 3300010167 Bacteria 39492
57 Ga0466707_014408 3300042601 Bacteria 7037
58 Ga0466707_098843 3300042601 Bacteria 5482
59 Ga0466707_132813 3300042601 Bacteria 12489
60 Ga0466707_240968 3300042601 Bacteria 8586
61 Ga0466707_286354 3300042601 Bacteria 2958
62 Ga0466713_042887 3300042602 Bacteria 1980
63 IMNBL1DRAFT_c0020470 3300000062 Bacteria 2679
64 AustNasuHG_c1008762 3300000089 Bacteria 3578
65 AustNasuHG_c1029799 3300000089 Bacteria 1588
66 JGI24698J34947_10000167 3300002449 Bacteria 25410
67 JGI24698J34947_10013574 3300002449 Bacteria 4445
68 JGI24695J34938_10000824 3300002450 Bacteria 28821
69 Ga0264413_110011 3300024493 Bacteria 12497
70 Ga0264413_131955 3300024493 Bacteria 11415
71 Ga0466694_280350 3300042594 Bacteria 1160
72 Ga0466734_144012 3300042623 Bacteria 1414
73 Ga0466725_271824 3300042654 Bacteria 38072
74 Ga0466727_319211 3300042655 Bacteria 5852
75 Ga0466711_025303 3300042615 Bacteria 1988
76 Ga0466715_196734 3300042616 Bacteria 9515
77 Ga0466718_030387 3300042617 Bacteria 8556
78 Ga0466726_014805 3300042619 Bacteria 2605
79 Ga0466726_204859 3300042619 Bacteria 1104
80 Ga0466728_095606 3300042620 Bacteria 1710
81 Ga0466705_287979 3300042612 Bacteria 17567
82 Ga0466706_190569 3300042599 Bacteria 1301
83 Ga0466707_147300 3300042601 Bacteria 3405
84 Ga0466714_027516 3300042603 Bacteria 2096
85 Ga0466714_059458 3300042603 Bacteria 5775
86 Ga0466714_162413 3300042603 Bacteria 5353
87 Ga0466716_372188 3300042605 Unclassified 1876
88 Ga0072940_1323923 3300005200 Bacteria 1461
89 Ga0072941_1001755 3300005201 Bacteria 19983
90 Ga0466657_044925 3300042582 Bacteria 2940
91 Ga0466690_167381 3300042590 Bacteria 10542
92 Ga0466703_254670 3300042636 Bacteria 13738
93 Ga0466704_253283 3300042643 Bacteria 11508
94 Ga0466705_525711 3300042612 Bacteria 1722
95 Ga0466732_400810 3300042656 Bacteria 1921
96 Ga0466733_003120 3300042659 Bacteria 6103
97 Ga0466733_216185 3300042659 Bacteria 59972
98 Ga0466706_094104 3300042599 Bacteria 1357
99 Ga0466706_120334 3300042599 Bacteria 4075
100 Ga0466700_078006 3300042600 Bacteria 4511
101 Ga0466714_108173 3300042603 Bacteria 16142
102 Ga0466719_413922 3300042606 Bacteria 1609
103 Ga0466720_128554 3300042607 Bacteria 11884
104 Ga0466722_231247 3300042609 Bacteria 8490
105 IMNBL1DRAFT_c0003365 3300000062 Bacteria 10372
106 AustNasuHG_c1030359 3300000089 Bacteria 1557
107 JGI24702J35022_10006245 3300002462 Bacteria 6899
108 Ga0072941_1032976 3300005201 Bacteria 15872
109 Ga0265387_1008449 3300024582 Bacteria 1384
110 Ga0466694_404950 3300042594 Bacteria 2089
111 Ga0466696_439534 3300042596 Bacteria 1524
112 Ga0466731_292739 3300042622 Bacteria 1062
113 Ga0466734_064463 3300042623 Bacteria 5042
114 Ga0466734_075259 3300042623 Bacteria 2512
115 Ga0466703_022920 3300042636 Archaea 57762
116 Ga0466703_262792 3300042636 Bacteria 5331
117 Ga0466704_172456 3300042643 Bacteria 26101
118 Ga0466704_326053 3300042643 Unclassified 5214
119 Ga0466704_332711 3300042643 Bacteria 13363
120 Ga0466709_397404 3300042648 Bacteria 20612
121 Ga0466705_442410 3300042612 Bacteria 5998
122 Ga0466726_142262 3300042619 Bacteria 5936
123 Ga0466728_131145 3300042620 Bacteria 2077
124 Ga0123355_10011608 3300009826 Bacteria 13590
125 Ga0123355_10032260 3300009826 Bacteria 8501
126 Ga0466706_130015 3300042599 Bacteria 11324
127 Ga0466707_122047 3300042601 Archaea 3164
128 Ga0466707_387519 3300042601 Bacteria 1849
129 Ga0466719_389448 3300042606 Bacteria 2574
130 2227354962 2225789004 Bacteria 1135
131 IMNBL1DRAFT_c0027760 3300000062 Unclassified 2122
132 JGI24698J34947_10040286 3300002449 Unclassified 2413
133 JGI24695J34938_10045985 3300002450 Bacteria 1933
134 JGI24702J35022_10060475 3300002462 Bacteria 2025
135 Ga0072941_1039411 3300005201 Bacteria 9118
136 Ga0466690_207409 3300042590 Bacteria 33870
137 Ga0466699_025233 3300042597 Bacteria 3368
138 Ga0466731_341774 3300042622 Bacteria 1339
139 Ga0466735_210296 3300042624 Bacteria 2332
140 Ga0466702_348767 3300042635 Bacteria 2720
141 Ga0466704_035124 3300042643 Bacteria 2674
142 Ga0466715_623388 3300042616 Bacteria 9065
143 Ga0466718_029210 3300042617 Bacteria 1443
144 Ga0466729_095556 3300042621 Bacteria 4687
145 Ga0466729_170379 3300042621 Bacteria 23377
146 Ga0466705_015956 3300042612 Bacteria 2047
147 Ga0466705_175300 3300042612 Bacteria 5208
148 Ga0466705_229829 3300042612 Bacteria 1353
149 Ga0123356_10371568 3300010049 Bacteria 1560
150 Ga0123356_10422109 3300010049 Bacteria 1476
151 Ga0466714_045578 3300042603 Bacteria 5785
152 Ga0466714_129021 3300042603 Bacteria 2364
153 Ga0466716_079514 3300042605 Unclassified 17801
154 Ga0466719_305821 3300042606 Bacteria 1314
155 IMNBL1DRAFT_c0038036 3300000062 Bacteria 1660
156 Ga0068305_10379687 3300005083 Bacteria 1232
157 Ga0264413_115724 3300024493 Bacteria 1214
158 Ga0466696_204011 3300042596 Bacteria 5094
159 Ga0466729_286783 3300042621 Bacteria 1884
160 Ga0466734_038848 3300042623 Archaea 16796
161 Ga0466702_014325 3300042635 Bacteria 1577
162 Ga0466704_048167 3300042643 Bacteria 9597
163 Ga0466704_261846 3300042643 Bacteria 6377
164 Ga0466712_116232 3300042614 Bacteria 1111
165 Ga0466711_280564 3300042615 Bacteria 8476
166 Ga0466729_081091 3300042621 Bacteria 5534
167 Ga0466729_166378 3300042621 Bacteria 1264
168 Ga0466705_369452 3300042612 Bacteria 8238
169 Ga0466732_399713 3300042656 Bacteria 3025
170 Ga0466733_128787 3300042659 Bacteria 4610
171 Ga0466733_181704 3300042659 Bacteria 1163
172 Ga0123357_10043338 3300009784 Bacteria 6115
173 Ga0123356_10045431 3300010049 Bacteria 4087
174 Ga0123356_10559723 3300010049 Bacteria 1305
175 Ga0466716_004650 3300042605 Bacteria 2520
176 Ga0466720_070734 3300042607 Bacteria 10485
177 Ga0466722_014050 3300042609 Bacteria 6034
178 Ga0466697_034899 3300042611 Bacteria 2095
179 JGI24702J35022_10127270 3300002462 Bacteria 1411
180 Ga0264413_101524 3300024493 Unclassified 12662
181 Ga0264413_115790 3300024493 Bacteria 2127
182 Ga0466657_328206 3300042582 Bacteria 12184
183 Ga0466692_130373 3300042591 Bacteria 1957
184 Ga0466691_065384 3300042593 Bacteria 40870
185 Ga0466729_264517 3300042621 Bacteria 26130
186 Ga0466735_100804 3300042624 Bacteria 4819
187 Ga0466702_384345 3300042635 Bacteria 1988
188 Ga0466703_015403 3300042636 Bacteria 15429
189 Ga0466703_200318 3300042636 Bacteria 5141
190 Ga0466704_163255 3300042643 Bacteria 5080
191 Ga0466725_336562 3300042654 Bacteria 6345
192 Ga0466715_300742 3300042616 Bacteria 10321

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_130015 Ga0466706_130015_741_1721 326
2 3300000062 IMNBL1DRAFT_c0003365 IMNBL1DRAFT_00033657 327
3 3300042582 Ga0466657_044925 Ga0466657_044925_1234_2220 328
4 3300042599 Ga0466706_255820 Ga0466706_255820_2472_3458 328
5 3300042601 Ga0466707_098843 Ga0466707_098843_4247_5233 328
6 3300042612 Ga0466705_437875 Ga0466705_437875_109_1095 328
7 3300042615 Ga0466711_069341 Ga0466711_069341_4782_5768 328
8 3300042615 Ga0466711_280564 Ga0466711_280564_3774_4760 328
9 3300042624 Ga0466735_100804 Ga0466735_100804_550_1536 328
10 3300042597 Ga0466699_025233 Ga0466699_025233_1525_2514 329
11 3300042623 Ga0466734_064463 Ga0466734_064463_3814_4803 329
12 3300042643 Ga0466704_048167 Ga0466704_048167_3909_4901 330
13 2225789004 2227323852 2227771963 331
14 3300002449 JGI24698J34947_10040286 JGI24698J34947_100402864 331
15 3300009826 Ga0123355_10032260 Ga0123355_100322606 331
16 3300042601 Ga0466707_122047 Ga0466707_122047_232_1227 331
17 3300042614 Ga0466712_116232 Ga0466712_116232_101_1096 331
18 3300042623 Ga0466734_075259 Ga0466734_075259_1194_2189 331
19 3300002462 JGI24702J35022_10127270 JGI24702J35022_101272701 332
20 3300042621 Ga0466729_166378 Ga0466729_166378_98_1096 332
21 3300042655 Ga0466727_104488 Ga0466727_104488_89_1087 332
22 3300042582 Ga0466657_328206 Ga0466657_328206_3437_4438 333
23 3300042590 Ga0466690_041758 Ga0466690_041758_943_1944 333
24 3300042596 Ga0466696_113521 Ga0466696_113521_34440_35441 333
25 3300042596 Ga0466696_439534 Ga0466696_439534_487_1488 333
26 3300042603 Ga0466714_059458 Ga0466714_059458_1542_2543 333
27 3300042606 Ga0466719_389448 Ga0466719_389448_1477_2478 333
28 3300042611 Ga0466697_034899 Ga0466697_034899_1036_2037 333
29 3300042612 Ga0466705_369452 Ga0466705_369452_1433_2434 333
30 3300042621 Ga0466729_095556 Ga0466729_095556_2433_3434 333
31 3300042643 Ga0466704_253283 Ga0466704_253283_10098_11099 333
32 3300042643 Ga0466704_261846 Ga0466704_261846_419_1420 333
33 3300042654 Ga0466725_271824 Ga0466725_271824_34345_35346 333
34 iso_pr_bacteria 2820711732 2820712075 333
35 2225789004 2227354962 2227799949 334
36 3300005200 Ga0072940_1323923 Ga0072940_13239231 334
37 3300009826 Ga0123355_10011608 Ga0123355_100116085 334
38 3300010167 Ga0123353_10291110 Ga0123353_102911102 334
39 3300042591 Ga0466692_130373 Ga0466692_130373_247_1251 334
40 3300042599 Ga0466706_094104 Ga0466706_094104_294_1298 334
41 3300042603 Ga0466714_045578 Ga0466714_045578_2100_3104 334
42 3300042603 Ga0466714_108173 Ga0466714_108173_8706_9710 334
43 3300042612 Ga0466705_287979 Ga0466705_287979_11254_12258 334
44 3300042615 Ga0466711_266206 Ga0466711_266206_2091_3095 334
45 3300042619 Ga0466726_084081 Ga0466726_084081_1340_2344 334
46 3300042621 Ga0466729_286783 Ga0466729_286783_125_1129 334
47 3300042655 Ga0466727_319211 Ga0466727_319211_4813_5817 334
48 iso_pr_bacteria 2820558799 2820559674 334
49 iso_pr_bacteria 2820671341 2820671556 334
50 iso_pr_bacteria 2820946191 2820947647 334
51 3300002450 JGI24695J34938_10000824 JGI24695J34938_1000082410 335
52 3300010167 Ga0123353_10000745 Ga0123353_1000074515 335
53 3300024493 Ga0264413_110011 Ga0264413_11001110 335
54 3300024493 Ga0264413_131955 Ga0264413_1319556 335
55 3300042590 Ga0466690_207409 Ga0466690_207409_21670_22677 335
56 3300042603 Ga0466714_027516 Ga0466714_027516_967_1974 335
57 3300042603 Ga0466714_162413 Ga0466714_162413_3953_4960 335
58 3300042604 Ga0466717_231829 Ga0466717_231829_871_1878 335
59 3300042616 Ga0466715_196734 Ga0466715_196734_5811_6818 335
60 3300042622 Ga0466731_292739 Ga0466731_292739_10_1017 335
61 3300042622 Ga0466731_341774 Ga0466731_341774_217_1224 335
62 3300042643 Ga0466704_035124 Ga0466704_035124_659_1666 335
63 3300042659 Ga0466733_115480 Ga0466733_115480_168_1175 335
64 3300042659 Ga0466733_128787 Ga0466733_128787_876_1883 335
65 3300042659 Ga0466733_181704 Ga0466733_181704_133_1140 335
66 3300042659 Ga0466733_216185 Ga0466733_216185_26932_27939 335
67 iso_pr_bacteria 2820719201 2820720559 335
68 iso_pr_bacteria 2820831444 2820832199 335
69 3300010049 Ga0123356_10371568 Ga0123356_103715682 336
70 3300010049 Ga0123356_10422109 Ga0123356_104221092 336
71 3300010167 Ga0123353_10003004 Ga0123353_100030044 336
72 3300042601 Ga0466707_147300 Ga0466707_147300_2365_3375 336
73 3300042601 Ga0466707_387519 Ga0466707_387519_639_1649 336
74 3300042619 Ga0466726_089937 Ga0466726_089937_77_1087 336
75 3300042619 Ga0466726_204859 Ga0466726_204859_61_1071 336
76 3300042621 Ga0466729_170379 Ga0466729_170379_20232_21242 336
77 3300042622 Ga0466731_128444 Ga0466731_128444_304_1314 336
78 3300042636 Ga0466703_262792 Ga0466703_262792_613_1623 336
79 3300042655 Ga0466727_191999 Ga0466727_191999_288_1298 336
80 2225789003 2226985944 2227333590 337
81 2225789004 2227501582 2227984776 337
82 3300000089 AustNasuHG_c1030359 AustNasuHG_10303592 337
83 3300005083 Ga0068305_10379687 Ga0068305_103796871 337
84 3300009784 Ga0123357_10043338 Ga0123357_100433382 337
85 3300024493 Ga0264413_101524 Ga0264413_10152410 337
86 3300024493 Ga0264413_115724 Ga0264413_1157241 337
87 3300024493 Ga0264413_115790 Ga0264413_1157902 337
88 3300042599 Ga0466706_179014 Ga0466706_179014_21783_22796 337
89 3300042601 Ga0466707_109335 Ga0466707_109335_2432_3445 337
90 3300042601 Ga0466707_240968 Ga0466707_240968_5645_6658 337
91 3300042605 Ga0466716_116636 Ga0466716_116636_1557_2570 337
92 3300042607 Ga0466720_128554 Ga0466720_128554_7278_8291 337
93 3300042612 Ga0466705_229829 Ga0466705_229829_142_1155 337
94 3300042619 Ga0466726_014805 Ga0466726_014805_1454_2467 337
95 3300042619 Ga0466726_142262 Ga0466726_142262_4222_5235 337
96 3300042621 Ga0466729_128850 Ga0466729_128850_108_1121 337
97 3300042623 Ga0466734_038848 Ga0466734_038848_15122_16135 337
98 3300042635 Ga0466702_348767 Ga0466702_348767_1600_2613 337
99 3300042635 Ga0466702_384345 Ga0466702_384345_706_1719 337
100 3300042659 Ga0466733_003120 Ga0466733_003120_3175_4188 337
101 3300042659 Ga0466733_188132 Ga0466733_188132_135_1148 337
102 3300000062 IMNBL1DRAFT_c0000045 IMNBL1DRAFT_000004541 338
103 3300005201 Ga0072941_1001755 Ga0072941_100175512 338
104 3300042600 Ga0466700_078006 Ga0466700_078006_1906_2922 338
105 3300042601 Ga0466707_119591 Ga0466707_119591_27_1043 338
106 3300042603 Ga0466714_129021 Ga0466714_129021_1072_2088 338
107 3300042612 Ga0466705_525711 Ga0466705_525711_207_1223 338
108 3300042615 Ga0466711_067304 Ga0466711_067304_210_1226 338
109 3300042616 Ga0466715_300742 Ga0466715_300742_9028_10044 338
110 3300042620 Ga0466728_095606 Ga0466728_095606_401_1417 338
111 3300042620 Ga0466728_131145 Ga0466728_131145_187_1203 338
112 3300042621 Ga0466729_081091 Ga0466729_081091_3197_4264 338
113 3300042659 Ga0466733_095137 Ga0466733_095137_262_1278 338
114 3300002450 JGI24695J34938_10045985 JGI24695J34938_100459852 339
115 3300005201 Ga0072941_1032976 Ga0072941_10329765 339
116 3300009784 Ga0123357_10345239 Ga0123357_103452391 339
117 3300042594 Ga0466694_280350 Ga0466694_280350_110_1129 339
118 3300042601 Ga0466707_286354 Ga0466707_286354_1894_2913 339
119 3300042601 Ga0466707_286606 Ga0466707_286606_155_1174 339
120 3300042616 Ga0466715_623388 Ga0466715_623388_442_1461 339
121 3300042624 Ga0466735_210296 Ga0466735_210296_1060_2079 339
122 3300042636 Ga0466703_197231 Ga0466703_197231_2574_3593 339
123 3300042636 Ga0466703_254670 Ga0466703_254670_4015_5034 339
124 3300042654 Ga0466725_336562 Ga0466725_336562_1523_2542 339
125 3300000062 IMNBL1DRAFT_c0038036 IMNBL1DRAFT_00380362 340
126 3300002462 JGI24702J35022_10060475 JGI24702J35022_100604751 340
127 3300010049 Ga0123356_10045431 Ga0123356_100454313 340
128 3300010049 Ga0123356_10559723 Ga0123356_105597232 340
129 3300010167 Ga0123353_10775388 Ga0123353_107753881 340
130 3300010882 Ga0123354_10247535 Ga0123354_102475352 340
131 3300024582 Ga0265387_1008449 Ga0265387_10084492 340
132 3300042590 Ga0466690_167381 Ga0466690_167381_5455_6477 340
133 3300042593 Ga0466691_065384 Ga0466691_065384_9826_10848 340
134 3300042596 Ga0466696_204011 Ga0466696_204011_2544_3566 340
135 3300042596 Ga0466696_290099 Ga0466696_290099_220_1242 340
136 3300042602 Ga0466713_042887 Ga0466713_042887_165_1187 340
137 3300042602 Ga0466713_123884 Ga0466713_123884_246_1268 340
138 3300042605 Ga0466716_079514 Ga0466716_079514_12157_13179 340
139 3300042605 Ga0466716_358018 Ga0466716_358018_139_1161 340
140 3300042605 Ga0466716_372188 Ga0466716_372188_645_1667 340
141 3300042606 Ga0466719_305821 Ga0466719_305821_14_1036 340
142 3300042607 Ga0466720_070734 Ga0466720_070734_4531_5553 340
143 3300042608 Ga0466721_212023 Ga0466721_212023_26_1048 340
144 3300042609 Ga0466722_014050 Ga0466722_014050_925_1947 340
145 3300042612 Ga0466705_004115 Ga0466705_004115_2285_3307 340
146 3300042612 Ga0466705_129799 Ga0466705_129799_724_1746 340
147 3300042612 Ga0466705_175300 Ga0466705_175300_3941_4963 340
148 3300042612 Ga0466705_442410 Ga0466705_442410_3405_4427 340
149 3300042615 Ga0466711_025258 Ga0466711_025258_26328_27350 340
150 3300042617 Ga0466718_029210 Ga0466718_029210_333_1355 340
151 3300042617 Ga0466718_030387 Ga0466718_030387_128_1150 340
152 3300042620 Ga0466728_065585 Ga0466728_065585_64_1086 340
153 3300042621 Ga0466729_047133 Ga0466729_047133_8425_9447 340
154 3300042621 Ga0466729_264517 Ga0466729_264517_23826_24848 340
155 3300042622 Ga0466731_272421 Ga0466731_272421_112_1134 340
156 3300042623 Ga0466734_144012 Ga0466734_144012_66_1088 340
157 3300042635 Ga0466702_014325 Ga0466702_014325_325_1347 340
158 3300042643 Ga0466704_148028 Ga0466704_148028_6140_7162 340
159 3300042643 Ga0466704_163255 Ga0466704_163255_2366_3388 340
160 3300042643 Ga0466704_172456 Ga0466704_172456_24116_25138 340
161 3300042643 Ga0466704_326053 Ga0466704_326053_2162_3184 340
162 3300042656 Ga0466732_399713 Ga0466732_399713_1734_2756 340
163 3300042656 Ga0466732_400810 Ga0466732_400810_270_1292 340
164 iso_pr_bacteria 2772190975 2773722366 340
165 3300002449 JGI24698J34947_10000167 JGI24698J34947_1000016729 341
166 3300002449 JGI24698J34947_10013574 JGI24698J34947_100135742 341
167 3300005201 Ga0072941_1039411 Ga0072941_10394113 341
168 3300010049 Ga0123356_10436761 Ga0123356_104367611 341
169 3300042601 Ga0466707_132813 Ga0466707_132813_11205_12230 341
170 3300042605 Ga0466716_004650 Ga0466716_004650_1214_2239 341
171 3300042612 Ga0466705_015956 Ga0466705_015956_493_1518 341
172 3300042636 Ga0466703_203043 Ga0466703_203043_4990_6015 341
173 3300042599 Ga0466706_120334 Ga0466706_120334_444_1472 342
174 3300042599 Ga0466706_190569 Ga0466706_190569_52_1080 342
175 3300042618 Ga0466723_218913 Ga0466723_218913_3521_4549 342
176 3300042636 Ga0466703_200318 Ga0466703_200318_3922_4950 342
177 3300042648 Ga0466709_397404 Ga0466709_397404_4964_5992 342
178 3300042654 Ga0466725_380346 Ga0466725_380346_138_1166 342
179 3300042659 Ga0466733_033499 Ga0466733_033499_9380_10408 342
180 3300000062 IMNBL1DRAFT_c0000444 IMNBL1DRAFT_000044426 343
181 3300000089 AustNasuHG_c1029799 AustNasuHG_10297992 343
182 3300042599 Ga0466706_166865 Ga0466706_166865_4234_5265 343
183 3300042636 Ga0466703_015403 Ga0466703_015403_3284_4315 343
184 3300042643 Ga0466704_332711 Ga0466704_332711_340_1371 343
185 iso_pr_bacteria 2820634724 2820635489 343
186 3300000062 IMNBL1DRAFT_c0020470 IMNBL1DRAFT_00204701 344
187 3300000062 IMNBL1DRAFT_c0027760 IMNBL1DRAFT_00277601 344
188 3300002462 JGI24702J35022_10006245 JGI24702J35022_100062452 345
189 3300042636 Ga0466703_022920 Ga0466703_022920_48246_49283 345
190 3300042609 Ga0466722_231247 Ga0466722_231247_4068_5108 346
191 3300042615 Ga0466711_122715 Ga0466711_122715_4295_5335 346
192 iso_pr_bacteria 2609459943 2610743106 346
193 iso_pr_bacteria 2830041218 2830044882 346
194 iso_pr_bacteria 2940209341 2940209731 346
195 iso_pr_bacteria 2820220859 2820223105 347
196 3300000089 AustNasuHG_c1008762 AustNasuHG_10087623 348
197 3300002462 JGI24702J35022_10004305 JGI24702J35022_100043057 348
198 3300042601 Ga0466707_014408 Ga0466707_014408_3788_4843 351
199 3300042606 Ga0466719_413922 Ga0466719_413922_341_1411 356
200 3300042615 Ga0466711_515405 Ga0466711_515405_1242_2348 368
201 3300042601 Ga0466707_309971 Ga0466707_309971_50_1165 371
202 3300042615 Ga0466711_025303 Ga0466711_025303_241_1359 372
203 3300042594 Ga0466694_404950 Ga0466694_404950_489_1634 381
204 3300042655 Ga0466727_173493 Ga0466727_173493_3785_5005 406

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13310 Virulence_RhuM Virulence protein RhuM family 65 308 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.45 0.49 Low

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.