Protein Family IF06322

Metagenome Metatranscriptome Isolate
199 Members
81 Samples
174 Scaffolds
345.14 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_085920|Ga0466716_085920_121_1293
Length
390 aa
Sequence
MNICIMPQRKGIELVRHSGFLIAGILNLYDDESMKHCFIDSMGEKTMKALVLEEKKKLSLRDFPTAETVGPYDVKIQIKACGICGSDVHYYLEGAIGDFVVRAPMILGHEAAGIVIEKGEQVRNLAVGDLVCMEPGIPNMRSPEVMDGMYNIDPGVVFWATPPVHGCLRETVVHPAQFCFKLPAGMSAAEGAMMEPLAIGIEAAKKASIKPGDTALVVGCGTIGVMCAISALAGGCGKVFISDVKQEKLDLAGAYDKNIVPVNTLKTDLREFIIKETAGKGCGVIFEASGSPKVYPDFFRCARKGARVVLVGLMNGTVPVDVNFLSAQGITIESIFRYTNCFDRAIALVNAGKIDIKRFISKTFKFEDAIAAYEYAAAGHPDVVKVMIEL

📊 Sample Types

Isolate 12.1%
Metagenome 77.4%
MAG 0.0%
Metatranscriptome 10.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Tenebrionidae 28.2%
Apidae 26.9%
Kalotermitidae 17.9%
Unclassified 7.7%
Termitidae 6.4%
Rhinotermitidae 5.1%
Termopsidae 3.8%
Culicidae 2.6%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 1
Bacteria 159
Eukaryota 0
Viruses 0
Unclassified 39

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2884203697 Commensalibacter melissae ESL0284 Isolate Apidae
2 2891591111 Commensalibacter sp. ESL0382 Isolate Unclassified
3 2891610497 Commensalibacter melissae ESL0367 Isolate Apidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300060699 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
9 3300060706 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
10 3300060708 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
16 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
17 8074882376 Commensalibacter sp. M0270 Isolate Apidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 3300060749 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
23 3300060754 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
24 650716102 Treponema primitia ZAS-2 Isolate Unclassified
25 8074737057 Commensalibacter sp. M0357 Isolate Apidae
26 8074873247 Commensalibacter sp. M0134 Isolate Apidae
27 8074876897 Commensalibacter sp. M0266 Isolate Apidae
28 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
29 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
30 3300060759 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
31 3300060764 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
32 3300060765 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
33 3300060766 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
34 3300060772 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
35 3300060774 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
36 8074745029 Commensalibacter melissae M0407 Isolate Apidae
37 8074748739 Commensalibacter sp. W8133 Isolate Apidae
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 2833052049 Commensalibacter melissae AMU001 Isolate Apidae
42 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
43 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
44 3300060748 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
45 3300060751 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
46 8074871419 Commensalibacter sp. M0133 Isolate Apidae
47 8074884171 Commensalibacter sp. M0355 Isolate Apidae
48 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
49 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 2891605396 Commensalibacter melissae ESL0392 Isolate Apidae
52 2891614855 Commensalibacter melissae ESL0379 Isolate Apidae
53 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
54 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
55 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
56 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
57 3300060698 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
58 3300061798 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
59 8074743123 Commensalibacter melissae M0402 Isolate Apidae
60 2891690481 Commensalibacter melissae ESL0390 Isolate Apidae
61 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
62 2756170209 Commensalibacter sp. ESL0284 Isolate Unclassified
63 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
64 3300060756 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
65 3300060769 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
66 3300060770 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
67 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
68 8074746876 Commensalibacter sp. W6292M3 Isolate Apidae
69 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
70 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
71 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
72 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
73 2891675627 Commensalibacter melissae ESL0366 Isolate Apidae
74 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
75 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
76 8074875073 Commensalibacter sp. M0265 Isolate Apidae
77 8074878724 Commensalibacter sp. M0267 Isolate Apidae
78 8074880551 Commensalibacter sp. M0268 Isolate Apidae
79 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
80 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
81 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_177028 3300042612 Bacteria 5081
2 Ga0562375_0359 3300056856 Bacteria 104954
3 Ga0590775_06333 3300060896 Unclassified 1730
4 Ga0466715_258770 3300042616 Bacteria 1408
5 Ga0466726_094093 3300042619 Bacteria 1736
6 Ga0466726_399617 3300042619 Unclassified 2995
7 Ga0466728_442600 3300042620 Bacteria 4085
8 Ga0160432_103458 3300012818 Bacteria 2342
9 Ga0466692_072553 3300042591 Bacteria 1748
10 Ga0466691_217421 3300042593 Bacteria 25353
11 Ga0466735_132073 3300042624 Bacteria 1661
12 Ga0466703_281979 3300042636 Bacteria 2051
13 Ga0466708_171719 3300042652 Bacteria 6379
14 Ga0466708_182888 3300042652 Bacteria 14480
15 Ga0466708_351434 3300042652 Bacteria 21031
16 Ga0466727_209489 3300042655 Bacteria 2779
17 Ga0466727_247129 3300042655 Bacteria 7375
18 Ga0466713_133200 3300042602 Bacteria 3496
19 Ga0466716_085920 3300042605 Unclassified 2687
20 Ga0466716_453433 3300042605 Bacteria 7332
21 Ga0466722_221081 3300042609 Bacteria 2106
22 Ga0466733_042984 3300042659 Bacteria 3250
23 Ga0562374_0862 3300057007 Bacteria 42445
24 Ga0466705_391893 3300042612 Bacteria 6821
25 Ga0466705_482560 3300042612 Bacteria 8885
26 Ga0466715_095578 3300042616 Bacteria 6097
27 Ga0466723_049591 3300042618 Unclassified 4972
28 Ga0466723_103671 3300042618 Bacteria 2849
29 Ga0466726_203388 3300042619 Bacteria 1438
30 Ga0466728_098635 3300042620 Bacteria 2356
31 Ga0160431_103209 3300012828 Bacteria 3461
32 Ga0160446_100214 3300012835 Unclassified 39522
33 Ga0456237_0000253 3300041968 Bacteria 7820
34 Ga0466690_345389 3300042590 Bacteria 2493
35 Ga0466692_072241 3300042591 Bacteria 6126
36 Ga0466693_278781 3300042592 Bacteria 6688
37 Ga0466691_161258 3300042593 Bacteria 8660
38 Ga0466696_186899 3300042596 Bacteria 28959
39 Ga0466704_035323 3300042643 Bacteria 7331
40 Ga0466704_147644 3300042643 Bacteria 2667
41 Ga0466704_217618 3300042643 Unclassified 1864
42 Ga0466709_367764 3300042648 Bacteria 15494
43 Ga0466727_160259 3300042655 Unclassified 1364
44 Ga0466727_302722 3300042655 Bacteria 5221
45 Ga0466713_105344 3300042602 Bacteria 53182
46 Ga0466722_012107 3300042609 Bacteria 8836
47 Ga0466733_139898 3300042659 Bacteria 3259
48 Ga0590768_06802 3300060754 Unclassified 1413
49 Ga0590789_04107 3300060766 Unclassified 1266
50 Ga0590798_03423 3300060774 Unclassified 1272
51 Ga0466711_230824 3300042615 Bacteria 16380
52 Ga0466723_054151 3300042618 Bacteria 8067
53 Ga0466691_133588 3300042593 Bacteria 5870
54 Ga0466691_143179 3300042593 Bacteria 3925
55 Ga0466696_362530 3300042596 Bacteria 19214
56 Ga0466703_122224 3300042636 Bacteria 1627
57 Ga0466704_567842 3300042643 Bacteria 2009
58 Ga0466709_108263 3300042648 Bacteria 10567
59 Ga0466708_326964 3300042652 Bacteria 3977
60 Ga0466706_055157 3300042599 Bacteria 1666
61 Ga0466716_214194 3300042605 Bacteria 1462
62 Ga0466719_499124 3300042606 Bacteria 2794
63 Ga0466705_345875 3300042612 Bacteria 1202
64 Ga0466733_180886 3300042659 Bacteria 1571
65 Ga0590805_03251 3300060698 Unclassified 1354
66 Ga0590788_04559 3300060765 Unclassified 1589
67 Ga0590793_02273 3300060769 Unclassified 1239
68 Ga0466723_124341 3300042618 Unclassified 5812
69 Ga0466723_191310 3300042618 Unclassified 13042
70 Ga0466726_240488 3300042619 Bacteria 5621
71 Ga0466728_018912 3300042620 Bacteria 6345
72 Ga0466728_029509 3300042620 Bacteria 1402
73 Ga0466728_092806 3300042620 Bacteria 8121
74 Ga0466728_160295 3300042620 Unclassified 2202
75 Ga0466728_249126 3300042620 Unclassified 1506
76 Ga0160454_101603 3300012798 Bacteria 3150
77 Ga0466690_118221 3300042590 Bacteria 39842
78 Ga0466690_250028 3300042590 Bacteria 4349
79 Ga0466704_207826 3300042643 Bacteria 1777
80 Ga0466709_144750 3300042648 Bacteria 5915
81 Ga0466709_368369 3300042648 Bacteria 4166
82 Ga0466709_387579 3300042648 Bacteria 1372
83 Ga0466713_097570 3300042602 Bacteria 2585
84 Ga0466713_131182 3300042602 Bacteria 5703
85 Ga0466713_147240 3300042602 Archaea 7174
86 Ga0466719_164850 3300042606 Unclassified 1489
87 Ga0466719_216569 3300042606 Bacteria 11180
88 Ga0466705_017642 3300042612 Bacteria 4057
89 Ga0466705_253516 3300042612 Bacteria 2849
90 Ga0590817_05662 3300060708 Unclassified 1288
91 Ga0590764_01961 3300060751 Unclassified 1592
92 Ga0590776_06842 3300060759 Unclassified 1309
93 Ga0590787_09090 3300060764 Unclassified 1130
94 Ga0590796_05667 3300060772 Unclassified 1263
95 Ga0466705_413824 3300042612 Unclassified 3504
96 Ga0466715_376540 3300042616 Bacteria 22885
97 Ga0466726_023122 3300042619 Bacteria 1974
98 Ga0466726_418838 3300042619 Bacteria 9491
99 Ga0466728_223444 3300042620 Bacteria 6073
100 Ga0466690_029870 3300042590 Bacteria 2652
101 Ga0466696_024085 3300042596 Bacteria 11928
102 Ga0466703_337284 3300042636 Bacteria 10215
103 Ga0466703_425933 3300042636 Bacteria 7650
104 Ga0466704_254801 3300042643 Bacteria 10052
105 Ga0466709_269585 3300042648 Bacteria 7750
106 Ga0466709_294094 3300042648 Bacteria 2019
107 Ga0466719_340184 3300042606 Bacteria 2667
108 Ga0466722_007494 3300042609 Bacteria 2659
109 Ga0074278_133158 3300005721 Bacteria 72460
110 Ga0466705_417420 3300042612 Unclassified 2555
111 Ga0466705_512635 3300042612 Unclassified 2936
112 Ga0466711_047053 3300042615 Bacteria 30744
113 Ga0466711_121267 3300042615 Bacteria 13072
114 Ga0466711_379461 3300042615 Bacteria 12930
115 Ga0466690_153446 3300042590 Bacteria 4952
116 Ga0466692_003088 3300042591 Bacteria 16524
117 Ga0466691_000472 3300042593 Bacteria 2710
118 Ga0466735_178763 3300042624 Bacteria 15666
119 Ga0466703_256743 3300042636 Bacteria 7746
120 Ga0466727_073363 3300042655 Bacteria 4243
121 Ga0466707_193595 3300042601 Bacteria 1559
122 Ga0466713_055343 3300042602 Bacteria 3506
123 Ga0466716_089114 3300042605 Bacteria 6426
124 Ga0466719_140625 3300042606 Bacteria 11371
125 Ga0466719_260597 3300042606 Bacteria 6316
126 Ga0466722_162418 3300042609 Bacteria 12534
127 Ga0466705_076053 3300042612 Bacteria 41201
128 Ga0466705_236753 3300042612 Bacteria 12299
129 Ga0562376_0002 3300056857 Bacteria 3502070
130 Ga0590806_03745 3300060699 Unclassified 1199
131 Ga0590815_02148 3300060706 Unclassified 3268
132 Ga0590761_06283 3300060748 Unclassified 1295
133 Ga0590772_07401 3300060756 Unclassified 1355
134 Ga0590776_07475 3300060759 Unclassified 1237
135 Ga0590794_06378 3300060770 Unclassified 1177
136 Ga0590770_03671 3300061798 Unclassified 1181
137 JGI24700J35501_10930734 3300002508 Bacteria 20835
138 Ga0466715_046010 3300042616 Bacteria 15636
139 Ga0466728_042684 3300042620 Bacteria 9092
140 Ga0466729_029425 3300042621 Bacteria 2161
141 Ga0466694_402863 3300042594 Bacteria 3870
142 Ga0466703_310751 3300042636 Bacteria 1800
143 Ga0466709_308001 3300042648 Bacteria 15552
144 Ga0466719_023100 3300042606 Bacteria 11033
145 Ga0466719_125640 3300042606 Bacteria 13314
146 Ga0466719_375271 3300042606 Bacteria 4947
147 Ga0466722_210988 3300042609 Bacteria 7631
148 Ga0590762_06057 3300060749 Unclassified 1515
149 Ga0466711_025214 3300042615 Bacteria 6087
150 Ga0466711_121629 3300042615 Bacteria 15493
151 Ga0466715_646675 3300042616 Bacteria 6058
152 Ga0466723_126513 3300042618 Bacteria 3083
153 Ga0466723_270192 3300042618 Unclassified 2450
154 Ga0466726_172097 3300042619 Bacteria 10480
155 Ga0466726_214244 3300042619 Bacteria 1887
156 Ga0466726_399829 3300042619 Bacteria 11107
157 Ga0466728_077041 3300042620 Bacteria 1907
158 Ga0160460_101181 3300012845 Bacteria 9948
159 Ga0466690_154565 3300042590 Unclassified 1260
160 Ga0466690_377352 3300042590 Unclassified 2126
161 Ga0466691_168383 3300042593 Bacteria 12520
162 Ga0466696_344367 3300042596 Bacteria 5538
163 Ga0466703_006251 3300042636 Bacteria 6154
164 Ga0466703_041211 3300042636 Bacteria 21273
165 Ga0466704_476010 3300042643 Bacteria 3492
166 Ga0466709_348920 3300042648 Bacteria 6096
167 Ga0466709_377760 3300042648 Bacteria 4294
168 Ga0466727_211180 3300042655 Bacteria 2321
169 Ga0466707_214682 3300042601 Bacteria 1417
170 Ga0466713_120432 3300042602 Bacteria 3816
171 Ga0466714_087941 3300042603 Bacteria 4190
172 Ga0466716_503912 3300042605 Bacteria 3939
173 Ga0466722_052023 3300042609 Unclassified 2119
174 Ga0466722_199430 3300042609 Bacteria 3209

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300060759 Ga0590776_06842 Ga0590776_06842_70_1035 321
2 3300060896 Ga0590775_06333 Ga0590775_06333_686_1651 321
3 3300042593 Ga0466691_000472 Ga0466691_000472_1664_2698 327
4 3300042602 Ga0466713_120432 Ga0466713_120432_525_1559 327
5 3300042636 Ga0466703_041211 Ga0466703_041211_14880_15914 327
6 3300042618 Ga0466723_124341 Ga0466723_124341_2463_3497 328
7 3300012798 Ga0160454_101603 Ga0160454_1016033 329
8 3300012835 Ga0160446_100214 Ga0160446_10021417 329
9 3300042606 Ga0466719_164850 Ga0466719_164850_439_1473 329
10 3300042605 Ga0466716_453433 Ga0466716_453433_3360_4394 330
11 3300042612 Ga0466705_482560 Ga0466705_482560_6629_7660 330
12 3300042648 Ga0466709_387579 Ga0466709_387579_162_1196 330
13 3300042602 Ga0466713_097570 Ga0466713_097570_233_1264 331
14 3300042606 Ga0466719_340184 Ga0466719_340184_1240_2274 331
15 3300042612 Ga0466705_076053 Ga0466705_076053_14619_15653 332
16 3300056857 Ga0562376_0002 Ga0562376_0002_734591_735589 332
17 3300042590 Ga0466690_029870 Ga0466690_029870_1581_2615 333
18 3300042609 Ga0466722_052023 Ga0466722_052023_284_1318 333
19 3300042612 Ga0466705_391893 Ga0466705_391893_239_1279 333
20 3300042609 Ga0466722_007494 Ga0466722_007494_1474_2508 334
21 3300042618 Ga0466723_103671 Ga0466723_103671_514_1548 334
22 3300042620 Ga0466728_098635 Ga0466728_098635_191_1228 334
23 3300042624 Ga0466735_178763 Ga0466735_178763_1022_2056 334
24 3300042593 Ga0466691_143179 Ga0466691_143179_1518_2552 335
25 3300042602 Ga0466713_131182 Ga0466713_131182_4491_5525 335
26 3300042602 Ga0466713_133200 Ga0466713_133200_2080_3114 335
27 3300012818 Ga0160432_103458 Ga0160432_1034582 336
28 3300012828 Ga0160431_103209 Ga0160431_1032093 336
29 3300012845 Ga0160460_101181 Ga0160460_1011819 336
30 3300042612 Ga0466705_253516 Ga0466705_253516_1167_2201 337
31 3300042636 Ga0466703_256743 Ga0466703_256743_5474_6508 337
32 3300042590 Ga0466690_345389 Ga0466690_345389_527_1561 338
33 3300042590 Ga0466690_250028 Ga0466690_250028_2194_3255 339
34 3300060764 Ga0590787_09090 Ga0590787_09090_56_1075 339
35 3300042590 Ga0466690_154565 Ga0466690_154565_200_1228 342
36 3300042593 Ga0466691_217421 Ga0466691_217421_6157_7185 342
37 3300042596 Ga0466696_344367 Ga0466696_344367_4024_5052 342
38 3300042616 Ga0466715_376540 Ga0466715_376540_6538_7566 342
39 3300042618 Ga0466723_049591 Ga0466723_049591_3055_4083 342
40 3300042619 Ga0466726_203388 Ga0466726_203388_178_1206 342
41 3300042620 Ga0466728_029509 Ga0466728_029509_266_1294 342
42 3300042636 Ga0466703_006251 Ga0466703_006251_1271_2299 342
43 3300042643 Ga0466704_217618 Ga0466704_217618_93_1121 342
44 3300042648 Ga0466709_294094 Ga0466709_294094_794_1822 342
45 3300042591 Ga0466692_003088 Ga0466692_003088_10353_11384 343
46 3300042591 Ga0466692_072241 Ga0466692_072241_861_1892 343
47 3300042602 Ga0466713_105344 Ga0466713_105344_26613_27644 343
48 3300042616 Ga0466715_095578 Ga0466715_095578_4868_5899 343
49 3300042619 Ga0466726_214244 Ga0466726_214244_821_1852 343
50 3300042619 Ga0466726_240488 Ga0466726_240488_3770_4801 343
51 3300042636 Ga0466703_281979 Ga0466703_281979_808_1839 343
52 3300042648 Ga0466709_368369 Ga0466709_368369_3022_4053 343
53 3300042655 Ga0466727_211180 Ga0466727_211180_180_1211 343
54 3300042655 Ga0466727_247129 Ga0466727_247129_1002_2033 343
55 3300042659 Ga0466733_042984 Ga0466733_042984_2015_3046 343
56 3300042659 Ga0466733_139898 Ga0466733_139898_1930_2961 343
57 3300042659 Ga0466733_180886 Ga0466733_180886_124_1155 343
58 3300056856 Ga0562375_0359 Ga0562375_0359_80504_81535 343
59 3300057007 Ga0562374_0862 Ga0562374_0862_22672_23703 343
60 iso_pr_bacteria 2819994798 2819997216 343
61 3300002508 JGI24700J35501_10930734 JGI24700J35501_109307344 344
62 3300041968 Ga0456237_0000253 Ga0456237_0000253_4790_5824 344
63 3300042590 Ga0466690_118221 Ga0466690_118221_18566_19600 344
64 3300042590 Ga0466690_153446 Ga0466690_153446_3145_4179 344
65 3300042591 Ga0466692_072553 Ga0466692_072553_692_1726 344
66 3300042592 Ga0466693_278781 Ga0466693_278781_203_1237 344
67 3300042594 Ga0466694_402863 Ga0466694_402863_1732_2766 344
68 3300042596 Ga0466696_024085 Ga0466696_024085_6934_7968 344
69 3300042599 Ga0466706_055157 Ga0466706_055157_214_1248 344
70 3300042601 Ga0466707_193595 Ga0466707_193595_31_1065 344
71 3300042601 Ga0466707_214682 Ga0466707_214682_231_1265 344
72 3300042602 Ga0466713_055343 Ga0466713_055343_1745_2779 344
73 3300042602 Ga0466713_147240 Ga0466713_147240_5101_6135 344
74 3300042605 Ga0466716_089114 Ga0466716_089114_126_1160 344
75 3300042605 Ga0466716_503912 Ga0466716_503912_2473_3507 344
76 3300042606 Ga0466719_125640 Ga0466719_125640_6356_7390 344
77 3300042606 Ga0466719_140625 Ga0466719_140625_884_1918 344
78 3300042606 Ga0466719_499124 Ga0466719_499124_427_1461 344
79 3300042609 Ga0466722_012107 Ga0466722_012107_5237_6271 344
80 3300042609 Ga0466722_162418 Ga0466722_162418_9557_10591 344
81 3300042609 Ga0466722_199430 Ga0466722_199430_244_1278 344
82 3300042612 Ga0466705_177028 Ga0466705_177028_2923_3957 344
83 3300042612 Ga0466705_345875 Ga0466705_345875_57_1091 344
84 3300042612 Ga0466705_413824 Ga0466705_413824_804_1838 344
85 3300042615 Ga0466711_047053 Ga0466711_047053_25775_26809 344
86 3300042615 Ga0466711_121267 Ga0466711_121267_4722_5756 344
87 3300042615 Ga0466711_121629 Ga0466711_121629_12697_13731 344
88 3300042615 Ga0466711_230824 Ga0466711_230824_3484_4518 344
89 3300042616 Ga0466715_046010 Ga0466715_046010_5159_6193 344
90 3300042618 Ga0466723_054151 Ga0466723_054151_2267_3301 344
91 3300042618 Ga0466723_270192 Ga0466723_270192_348_1382 344
92 3300042619 Ga0466726_023122 Ga0466726_023122_364_1398 344
93 3300042619 Ga0466726_094093 Ga0466726_094093_424_1458 344
94 3300042619 Ga0466726_172097 Ga0466726_172097_359_1393 344
95 3300042619 Ga0466726_399617 Ga0466726_399617_100_1134 344
96 3300042619 Ga0466726_418838 Ga0466726_418838_3545_4579 344
97 3300042620 Ga0466728_042684 Ga0466728_042684_3794_4828 344
98 3300042620 Ga0466728_092806 Ga0466728_092806_3344_4378 344
99 3300042620 Ga0466728_160295 Ga0466728_160295_244_1278 344
100 3300042620 Ga0466728_442600 Ga0466728_442600_1329_2363 344
101 3300042621 Ga0466729_029425 Ga0466729_029425_505_1539 344
102 3300042624 Ga0466735_132073 Ga0466735_132073_578_1612 344
103 3300042636 Ga0466703_337284 Ga0466703_337284_1168_2202 344
104 3300042636 Ga0466703_425933 Ga0466703_425933_4876_5910 344
105 3300042643 Ga0466704_147644 Ga0466704_147644_395_1429 344
106 3300042648 Ga0466709_108263 Ga0466709_108263_460_1494 344
107 3300042648 Ga0466709_348920 Ga0466709_348920_228_1295 344
108 3300042652 Ga0466708_182888 Ga0466708_182888_569_1603 344
109 3300042655 Ga0466727_073363 Ga0466727_073363_226_1260 344
110 3300042655 Ga0466727_160259 Ga0466727_160259_19_1053 344
111 3300042655 Ga0466727_209489 Ga0466727_209489_54_1088 344
112 3300042655 Ga0466727_302722 Ga0466727_302722_3366_4400 344
113 iso_pr_bacteria 650716102 650880876 344
114 3300042593 Ga0466691_161258 Ga0466691_161258_1900_2937 345
115 3300042593 Ga0466691_168383 Ga0466691_168383_2734_3771 345
116 3300042606 Ga0466719_023100 Ga0466719_023100_4125_5162 345
117 3300042606 Ga0466719_216569 Ga0466719_216569_622_1659 345
118 3300042606 Ga0466719_260597 Ga0466719_260597_4044_5081 345
119 3300042606 Ga0466719_375271 Ga0466719_375271_188_1225 345
120 3300042609 Ga0466722_221081 Ga0466722_221081_400_1437 345
121 3300042612 Ga0466705_417420 Ga0466705_417420_813_1850 345
122 3300042612 Ga0466705_512635 Ga0466705_512635_149_1186 345
123 3300042618 Ga0466723_126513 Ga0466723_126513_1043_2080 345
124 3300042620 Ga0466728_018912 Ga0466728_018912_5108_6145 345
125 3300042620 Ga0466728_077041 Ga0466728_077041_104_1141 345
126 3300042620 Ga0466728_223444 Ga0466728_223444_214_1251 345
127 3300042636 Ga0466703_310751 Ga0466703_310751_648_1685 345
128 3300042643 Ga0466704_035323 Ga0466704_035323_617_1654 345
129 3300042643 Ga0466704_207826 Ga0466704_207826_379_1416 345
130 3300042648 Ga0466709_308001 Ga0466709_308001_5524_6561 345
131 3300042648 Ga0466709_367764 Ga0466709_367764_6564_7601 345
132 3300042648 Ga0466709_377760 Ga0466709_377760_3015_4052 345
133 3300042652 Ga0466708_171719 Ga0466708_171719_5031_6068 345
134 3300042615 Ga0466711_025214 Ga0466711_025214_1694_2734 346
135 3300042620 Ga0466728_249126 Ga0466728_249126_161_1201 346
136 3300042636 Ga0466703_122224 Ga0466703_122224_497_1537 346
137 3300042648 Ga0466709_269585 Ga0466709_269585_2501_3541 346
138 3300042612 Ga0466705_236753 Ga0466705_236753_1677_2720 347
139 3300042652 Ga0466708_326964 Ga0466708_326964_1667_2749 347
140 iso_pr_bacteria 2756170209 2756539815 347
141 iso_pr_bacteria 2833052049 2833052098 347
142 iso_pr_bacteria 2884203697 2884203784 347
143 iso_pr_bacteria 2891591111 2891591198 347
144 iso_pr_bacteria 2891605396 2891605487 347
145 iso_pr_bacteria 2891610497 2891610584 347
146 iso_pr_bacteria 2891614855 2891614943 347
147 iso_pr_bacteria 2891675627 2891675714 347
148 iso_pr_bacteria 2891690481 2891690568 347
149 iso_pr_bacteria 8074737057 8074738323 347
150 iso_pr_bacteria 8074743123 8074744560 347
151 iso_pr_bacteria 8074745029 8074746465 347
152 iso_pr_bacteria 8074746876 8074748294 347
153 iso_pr_bacteria 8074748739 8074750236 347
154 iso_pr_bacteria 8074871419 8074872703 347
155 iso_pr_bacteria 8074873247 8074874680 347
156 iso_pr_bacteria 8074875073 8074876263 347
157 iso_pr_bacteria 8074876897 8074878327 347
158 iso_pr_bacteria 8074878724 8074880153 347
159 iso_pr_bacteria 8074880551 8074881722 347
160 iso_pr_bacteria 8074882376 8074883557 347
161 iso_pr_bacteria 8074884171 8074885432 347
162 3300005721 Ga0074278_133158 Ga0074278_13315813 348
163 3300042612 Ga0466705_017642 Ga0466705_017642_1070_2116 348
164 3300060770 Ga0590794_06378 Ga0590794_06378_65_1135 348
165 3300042616 Ga0466715_258770 Ga0466715_258770_120_1172 350
166 3300042596 Ga0466696_186899 Ga0466696_186899_26829_27884 351
167 3300042596 Ga0466696_362530 Ga0466696_362530_16221_17276 351
168 3300042616 Ga0466715_646675 Ga0466715_646675_2348_3403 351
169 3300042619 Ga0466726_399829 Ga0466726_399829_1513_2589 351
170 3300042643 Ga0466704_567842 Ga0466704_567842_828_1883 351
171 3300042648 Ga0466709_144750 Ga0466709_144750_1570_2625 351
172 3300042643 Ga0466704_476010 Ga0466704_476010_284_1345 353
173 3300042618 Ga0466723_191310 Ga0466723_191310_2581_3645 354
174 3300042609 Ga0466722_210988 Ga0466722_210988_4737_5879 355
175 3300060699 Ga0590806_03745 Ga0590806_03745_75_1145 356
176 3300060706 Ga0590815_02148 Ga0590815_02148_1903_2973 356
177 3300060706 Ga0590815_02148 Ga0590815_02148_350_1420 356
178 3300060748 Ga0590761_06283 Ga0590761_06283_126_1196 356
179 3300060749 Ga0590762_06057 Ga0590762_06057_347_1417 356
180 3300060751 Ga0590764_01961 Ga0590764_01961_338_1408 356
181 3300060754 Ga0590768_06802 Ga0590768_06802_291_1361 356
182 3300060756 Ga0590772_07401 Ga0590772_07401_153_1223 356
183 3300060765 Ga0590788_04559 Ga0590788_04559_380_1450 356
184 3300060766 Ga0590789_04107 Ga0590789_04107_75_1145 356
185 3300060769 Ga0590793_02273 Ga0590793_02273_95_1165 356
186 3300060772 Ga0590796_05667 Ga0590796_05667_78_1148 356
187 3300061798 Ga0590770_03671 Ga0590770_03671_84_1154 356
188 3300042593 Ga0466691_133588 Ga0466691_133588_4402_5484 360
189 3300042643 Ga0466704_254801 Ga0466704_254801_8279_9388 363
190 3300060698 Ga0590805_03251 Ga0590805_03251_92_1189 365
191 3300060759 Ga0590776_07475 Ga0590776_07475_33_1130 365
192 3300060774 Ga0590798_03423 Ga0590798_03423_82_1179 365
193 3300060708 Ga0590817_05662 Ga0590817_05662_67_1173 368
194 3300042590 Ga0466690_377352 Ga0466690_377352_92_1201 369
195 3300042605 Ga0466716_214194 Ga0466716_214194_277_1398 373
196 3300042603 Ga0466714_087941 Ga0466714_087941_1648_2778 376
197 3300042652 Ga0466708_351434 Ga0466708_351434_17401_18531 376
198 3300042615 Ga0466711_379461 Ga0466711_379461_126_1262 378
199 3300042605 Ga0466716_085920 Ga0466716_085920_121_1293 390

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 223 349 0.93
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 70 183 0.92
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 269 380 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.