Protein Family IF06320

Metagenome Isolate
142 Members
56 Samples
125 Scaffolds
131.49 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_076910|Ga0466716_076910_7997_8413
Length
138 aa
Sequence
MATLFSRIAAGEIPSHRIAGNDEFFAFLDINPIAEGHTLVIPKKEVDYLFDLDDDVLGRMMTFAKTVARALEQAIPCKRIGLTVIGLEVPHAHIHLVPLQKESDIFFGNPKLKKTPEELAQIAAKIRGKYSAIIQPVS

📊 Sample Types

Isolate 12.0%
Metagenome 88.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 29.1%
Kalotermitidae 25.5%
Termitidae 21.8%
Termopsidae 7.3%
Unclassified 5.5%
Passalidae 5.5%
Rhinotermitidae 3.6%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 141
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
2 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
16 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2923982719 Parabacteroides sp. 52 Isolate Blattidae
21 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
22 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
23 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
33 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
36 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
39 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
40 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
41 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
42 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
43 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
44 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
45 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
48 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
49 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
50 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
51 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
54 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
55 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
56 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_384103 3300042612 Bacteria 6183
2 Ga0466710_129526 3300042613 Bacteria 1517
3 Ga0466711_025564 3300042615 Bacteria 1625
4 Ga0466711_254661 3300042615 Bacteria 22153
5 Ga0466711_480922 3300042615 Bacteria 4951
6 Ga0466715_258739 3300042616 Bacteria 1438
7 Ga0466728_427153 3300042620 Bacteria 44524
8 Ga0466703_117633 3300042636 Bacteria 10873
9 Ga0466704_407394 3300042643 Bacteria 14777
10 Ga0466709_255680 3300042648 Bacteria 2123
11 Ga0466709_376503 3300042648 Bacteria 12791
12 JGI24702J35022_10033840 3300002462 Bacteria 2733
13 JGI24705J35276_12178884 3300002504 Bacteria 1350
14 Ga0068302_10022099 3300005071 Bacteria 1549
15 Ga0068302_10413639 3300005071 Bacteria 560
16 Ga0466706_123047 3300042599 Bacteria 432554
17 Ga0466713_138201 3300042602 Bacteria 41853
18 Ga0466716_170454 3300042605 Bacteria 10208
19 Ga0466705_053356 3300042612 Bacteria 6242
20 Ga0123353_10295733 3300010167 Bacteria 2476
21 Ga0466711_058781 3300042615 Bacteria 7314
22 Ga0466690_087595 3300042590 Bacteria 13158
23 Ga0466696_037645 3300042596 Bacteria 8146
24 Ga0466735_028570 3300042624 Bacteria 2879
25 Ga0466735_109569 3300042624 Bacteria 1400
26 Ga0466703_126384 3300042636 Bacteria 8446
27 Ga0466704_083976 3300042643 Bacteria 7082
28 Ga0466708_381916 3300042652 Bacteria 41700
29 Ga0466706_125382 3300042599 Bacteria 59039
30 Ga0466707_042066 3300042601 Bacteria 33916
31 Ga0466713_027975 3300042602 Bacteria 1324
32 Ga0466716_542452 3300042605 Bacteria 5808
33 Ga0466719_252418 3300042606 Unclassified 1270
34 Ga0466705_004213 3300042612 Bacteria 1042
35 Ga0123353_10418138 3300010167 Bacteria 1987
36 Ga0466715_016832 3300042616 Bacteria 13246
37 Ga0466723_210560 3300042618 Bacteria 37552
38 Ga0466729_189943 3300042621 Bacteria 4376
39 Ga0466690_161758 3300042590 Bacteria 3412
40 Ga0466696_367296 3300042596 Bacteria 3420
41 Ga0466735_110694 3300042624 Bacteria 2239
42 Ga0466735_207352 3300042624 Bacteria 2010
43 Ga0466735_214580 3300042624 Bacteria 2171
44 Ga0466703_289947 3300042636 Bacteria 14348
45 Ga0466704_488650 3300042643 Bacteria 2555
46 Ga0466727_225961 3300042655 Bacteria 24553
47 JGI24696J40584_12904969 3300002834 Bacteria 1211
48 Ga0068305_10143422 3300005083 Bacteria 6966
49 Ga0123353_10812231 3300010167 Bacteria 1289
50 Ga0466723_337834 3300042618 Bacteria 4456
51 Ga0466690_005157 3300042590 Bacteria 11484
52 Ga0466691_157934 3300042593 Bacteria 3307
53 Ga0466694_012818 3300042594 Bacteria 2704
54 Ga0466735_207439 3300042624 Bacteria 2290
55 Ga0466703_334723 3300042636 Bacteria 11651
56 Ga0466704_208378 3300042643 Bacteria 3095
57 Ga0466708_022235 3300042652 Bacteria 30512
58 2227078002 2225789003 Bacteria 10156
59 Ga0068302_10204565 3300005071 Bacteria 4487
60 Ga0466706_207386 3300042599 Bacteria 10137
61 Ga0466714_020508 3300042603 Bacteria 1841
62 Ga0466716_506495 3300042605 Bacteria 2935
63 Ga0466719_509416 3300042606 Bacteria 1300
64 Ga0466705_293308 3300042612 Bacteria 30605
65 Ga0466733_170460 3300042659 Bacteria 186955
66 Ga0466715_120257 3300042616 Bacteria 34712
67 Ga0466718_068814 3300042617 Bacteria 1429
68 Ga0466726_049116 3300042619 Bacteria 5096
69 Ga0466728_273031 3300042620 Bacteria 99357
70 Ga0466728_302644 3300042620 Bacteria 46015
71 Ga0466690_011114 3300042590 Bacteria 13045
72 Ga0466696_143335 3300042596 Bacteria 1155
73 Ga0466703_374666 3300042636 Bacteria 1379
74 2227108570 2225789004 Bacteria 39082
75 IMNBL1DRAFT_c0000419 3300000062 Bacteria 35673
76 JGI24702J35022_10058473 3300002462 Bacteria 2059
77 Ga0466716_076910 3300042605 Bacteria 11677
78 Ga0466722_068128 3300042609 Bacteria 5696
79 Ga0466722_199911 3300042609 Bacteria 40153
80 Ga0466715_164269 3300042616 Bacteria 10375
81 Ga0466726_298424 3300042619 Bacteria 2154
82 Ga0466726_313388 3300042619 Bacteria 1954
83 Ga0466729_188994 3300042621 Bacteria 1078
84 Ga0466704_426718 3300042643 Bacteria 2219
85 Ga0466704_475526 3300042643 Bacteria 7942
86 Ga0466709_201262 3300042648 Bacteria 3425
87 Ga0466725_423711 3300042654 Bacteria 4648
88 IMNBL1DRAFT_c0002120 3300000062 Bacteria 14126
89 JGI24695J34938_10152803 3300002450 Bacteria 946
90 JGI24705J35276_12229120 3300002504 Bacteria 3323
91 Ga0466707_308177 3300042601 Bacteria 5261
92 Ga0466713_085697 3300042602 Bacteria 7961
93 Ga0466719_263220 3300042606 Bacteria 12678
94 Ga0466719_343669 3300042606 Bacteria 7841
95 Ga0466705_213217 3300042612 Bacteria 15483
96 Ga0123353_10112877 3300010167 Bacteria 4375
97 Ga0466711_279510 3300042615 Bacteria 6646
98 Ga0466728_120091 3300042620 Bacteria 1456
99 Ga0466690_352947 3300042590 Bacteria 7135
100 Ga0466690_420312 3300042590 Bacteria 5387
101 Ga0466696_191370 3300042596 Bacteria 13083
102 Ga0466696_304362 3300042596 Bacteria 42297
103 Ga0466703_047779 3300042636 Bacteria 11370
104 Ga0466703_121629 3300042636 Bacteria 5016
105 Ga0466703_249920 3300042636 Bacteria 2476
106 Ga0466704_032420 3300042643 Bacteria 20055
107 Ga0466704_155503 3300042643 Bacteria 1078
108 Ga0466725_072352 3300042654 Bacteria 12854
109 Ga0466727_298968 3300042655 Bacteria 1168
110 Ga0466727_306985 3300042655 Bacteria 2983
111 IMNBL1DRAFT_c0011567 3300000062 Bacteria 4113
112 Ga0466722_065699 3300042609 Bacteria 1927
113 Ga0123356_11260271 3300010049 Bacteria 904
114 Ga0466711_098163 3300042615 Bacteria 8093
115 Ga0466711_182763 3300042615 Bacteria 4601
116 Ga0466711_443540 3300042615 Bacteria 17011
117 Ga0466715_483459 3300042616 Bacteria 9809
118 Ga0466728_390398 3300042620 Bacteria 71913
119 Ga0466696_360985 3300042596 Bacteria 2923
120 Ga0466708_120576 3300042652 Bacteria 34134
121 Ga0466727_047526 3300042655 Bacteria 13694
122 Ga0466707_218341 3300042601 Bacteria 1548
123 Ga0466716_073327 3300042605 Bacteria 12280
124 Ga0466716_335372 3300042605 Bacteria 21999
125 Ga0466719_127736 3300042606 Bacteria 12085

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_161758 Ga0466690_161758_1771_2166 122
2 3300042620 Ga0466728_302644 Ga0466728_302644_13855_14223 122
3 3300042620 Ga0466728_390398 Ga0466728_390398_61382_61750 122
4 3300042609 Ga0466722_199911 Ga0466722_199911_24318_24752 128
5 3300042620 Ga0466728_427153 Ga0466728_427153_36064_36450 128
6 3300002462 JGI24702J35022_10033840 JGI24702J35022_100338401 129
7 3300042601 Ga0466707_042066 Ga0466707_042066_31713_32102 129
8 3300042609 Ga0466722_065699 Ga0466722_065699_810_1199 129
9 3300042616 Ga0466715_483459 Ga0466715_483459_38_427 129
10 3300042636 Ga0466703_249920 Ga0466703_249920_557_946 129
11 3300042648 Ga0466709_201262 Ga0466709_201262_1561_1950 129
12 3300042596 Ga0466696_360985 Ga0466696_360985_172_564 130
13 3300042599 Ga0466706_125382 Ga0466706_125382_4991_5383 130
14 3300042601 Ga0466707_218341 Ga0466707_218341_738_1130 130
15 3300042602 Ga0466713_027975 Ga0466713_027975_607_999 130
16 3300042605 Ga0466716_073327 Ga0466716_073327_7001_7393 130
17 3300042605 Ga0466716_170454 Ga0466716_170454_3387_3779 130
18 3300042612 Ga0466705_213217 Ga0466705_213217_11191_11583 130
19 3300042616 Ga0466715_258739 Ga0466715_258739_155_547 130
20 3300042620 Ga0466728_273031 Ga0466728_273031_87976_88368 130
21 3300042624 Ga0466735_214580 Ga0466735_214580_509_901 130
22 3300042636 Ga0466703_126384 Ga0466703_126384_5420_5812 130
23 3300042654 Ga0466725_072352 Ga0466725_072352_7054_7446 130
24 3300042654 Ga0466725_423711 Ga0466725_423711_2880_3272 130
25 3300002450 JGI24695J34938_10152803 JGI24695J34938_101528032 131
26 3300002504 JGI24705J35276_12178884 JGI24705J35276_121788842 131
27 3300010049 Ga0123356_11260271 Ga0123356_112602711 131
28 3300010167 Ga0123353_10812231 Ga0123353_108122312 131
29 3300042590 Ga0466690_005157 Ga0466690_005157_5560_5955 131
30 3300042590 Ga0466690_011114 Ga0466690_011114_4595_4990 131
31 3300042590 Ga0466690_087595 Ga0466690_087595_255_650 131
32 3300042590 Ga0466690_420312 Ga0466690_420312_1245_1640 131
33 3300042593 Ga0466691_157934 Ga0466691_157934_120_515 131
34 3300042594 Ga0466694_012818 Ga0466694_012818_1173_1568 131
35 3300042596 Ga0466696_037645 Ga0466696_037645_6377_6772 131
36 3300042596 Ga0466696_143335 Ga0466696_143335_27_422 131
37 3300042596 Ga0466696_191370 Ga0466696_191370_6277_6672 131
38 3300042596 Ga0466696_304362 Ga0466696_304362_14031_14426 131
39 3300042596 Ga0466696_367296 Ga0466696_367296_2067_2462 131
40 3300042599 Ga0466706_207386 Ga0466706_207386_4010_4405 131
41 3300042601 Ga0466707_308177 Ga0466707_308177_322_717 131
42 3300042602 Ga0466713_085697 Ga0466713_085697_3439_3834 131
43 3300042605 Ga0466716_335372 Ga0466716_335372_858_1253 131
44 3300042605 Ga0466716_542452 Ga0466716_542452_1245_1640 131
45 3300042606 Ga0466719_252418 Ga0466719_252418_103_498 131
46 3300042606 Ga0466719_343669 Ga0466719_343669_6102_6497 131
47 3300042606 Ga0466719_509416 Ga0466719_509416_174_569 131
48 3300042612 Ga0466705_293308 Ga0466705_293308_25465_25860 131
49 3300042612 Ga0466705_384103 Ga0466705_384103_3063_3458 131
50 3300042613 Ga0466710_129526 Ga0466710_129526_544_939 131
51 3300042615 Ga0466711_098163 Ga0466711_098163_5971_6366 131
52 3300042615 Ga0466711_182763 Ga0466711_182763_558_953 131
53 3300042615 Ga0466711_279510 Ga0466711_279510_4814_5209 131
54 3300042615 Ga0466711_480922 Ga0466711_480922_2489_2884 131
55 3300042616 Ga0466715_016832 Ga0466715_016832_6388_6783 131
56 3300042616 Ga0466715_120257 Ga0466715_120257_16381_16776 131
57 3300042617 Ga0466718_068814 Ga0466718_068814_647_1042 131
58 3300042618 Ga0466723_337834 Ga0466723_337834_1275_1670 131
59 3300042619 Ga0466726_049116 Ga0466726_049116_702_1097 131
60 3300042619 Ga0466726_313388 Ga0466726_313388_332_727 131
61 3300042620 Ga0466728_120091 Ga0466728_120091_882_1277 131
62 3300042624 Ga0466735_028570 Ga0466735_028570_181_576 131
63 3300042624 Ga0466735_109569 Ga0466735_109569_123_518 131
64 3300042624 Ga0466735_110694 Ga0466735_110694_235_630 131
65 3300042624 Ga0466735_207352 Ga0466735_207352_915_1310 131
66 3300042636 Ga0466703_047779 Ga0466703_047779_3536_3931 131
67 3300042636 Ga0466703_117633 Ga0466703_117633_702_1097 131
68 3300042636 Ga0466703_334723 Ga0466703_334723_10958_11353 131
69 3300042643 Ga0466704_032420 Ga0466704_032420_9525_9920 131
70 3300042643 Ga0466704_155503 Ga0466704_155503_631_1026 131
71 3300042643 Ga0466704_208378 Ga0466704_208378_577_972 131
72 3300042643 Ga0466704_426718 Ga0466704_426718_264_659 131
73 3300042643 Ga0466704_475526 Ga0466704_475526_264_659 131
74 3300042643 Ga0466704_488650 Ga0466704_488650_507_902 131
75 3300042648 Ga0466709_255680 Ga0466709_255680_1038_1433 131
76 3300042648 Ga0466709_376503 Ga0466709_376503_4437_4832 131
77 3300042652 Ga0466708_022235 Ga0466708_022235_13842_14237 131
78 3300042652 Ga0466708_120576 Ga0466708_120576_19650_20045 131
79 3300042655 Ga0466727_047526 Ga0466727_047526_1201_1596 131
80 3300042655 Ga0466727_298968 Ga0466727_298968_470_865 131
81 3300042659 Ga0466733_170460 Ga0466733_170460_73013_73408 131
82 iso_pr_bacteria 2923982719 2923984514 131
83 iso_pr_bacteria 2940199050 2940201139 131
84 iso_pr_bacteria 2940205530 2940208985 131
85 iso_pr_bacteria 2940212447 2940215900 131
86 iso_pr_bacteria 2940298504 2940301940 131
87 iso_pr_bacteria 2940302308 2940305743 131
88 iso_pr_bacteria 2940306115 2940309635 131
89 iso_pr_bacteria 2940309933 2940313471 131
90 iso_pr_bacteria 2940313741 2940317299 131
91 iso_pr_bacteria 2940317558 2940321112 131
92 iso_pr_bacteria 2940321370 2940324855 131
93 iso_pr_bacteria 2940325180 2940328613 131
94 iso_pr_bacteria 2940328985 2940332420 131
95 iso_pr_bacteria 2940332795 2940336350 131
96 iso_pr_bacteria 2940346213 2940348051 131
97 iso_pr_bacteria 2940371297 2940372366 131
98 2225789003 2227078002 2227444599 132
99 2225789004 2227108570 2227495493 132
100 3300000062 IMNBL1DRAFT_c0002120 IMNBL1DRAFT_000212011 132
101 3300002462 JGI24702J35022_10058473 JGI24702J35022_100584732 132
102 3300005071 Ga0068302_10022099 Ga0068302_100220992 132
103 3300005071 Ga0068302_10204565 Ga0068302_102045655 132
104 3300005083 Ga0068305_10143422 Ga0068305_101434223 132
105 3300010167 Ga0123353_10112877 Ga0123353_101128772 132
106 3300010167 Ga0123353_10295733 Ga0123353_102957333 132
107 3300010167 Ga0123353_10418138 Ga0123353_104181383 132
108 3300042599 Ga0466706_123047 Ga0466706_123047_253741_254139 132
109 3300042606 Ga0466719_263220 Ga0466719_263220_11249_11647 132
110 3300042618 Ga0466723_210560 Ga0466723_210560_331_729 132
111 3300042619 Ga0466726_298424 Ga0466726_298424_145_543 132
112 3300042621 Ga0466729_189943 Ga0466729_189943_2883_3281 132
113 3300042643 Ga0466704_407394 Ga0466704_407394_3180_3578 132
114 3300042655 Ga0466727_306985 Ga0466727_306985_2248_2646 132
115 3300000062 IMNBL1DRAFT_c0000419 IMNBL1DRAFT_000041924 133
116 3300002834 JGI24696J40584_12904969 JGI24696J40584_129049692 133
117 3300005071 Ga0068302_10413639 Ga0068302_104136391 133
118 3300042609 Ga0466722_068128 Ga0466722_068128_4128_4529 133
119 3300042612 Ga0466705_053356 Ga0466705_053356_319_720 133
120 3300042624 Ga0466735_207439 Ga0466735_207439_1589_1990 133
121 3300042636 Ga0466703_374666 Ga0466703_374666_499_900 133
122 3300042643 Ga0466704_083976 Ga0466704_083976_4360_4761 133
123 3300042655 Ga0466727_225961 Ga0466727_225961_17021_17422 133
124 iso_pr_bacteria 2509276035 2509456907 133
125 3300000062 IMNBL1DRAFT_c0011567 IMNBL1DRAFT_00115674 134
126 3300042605 Ga0466716_506495 Ga0466716_506495_1069_1473 134
127 3300042612 Ga0466705_004213 Ga0466705_004213_132_536 134
128 3300042615 Ga0466711_254661 Ga0466711_254661_21385_21789 134
129 3300042616 Ga0466715_164269 Ga0466715_164269_5252_5656 134
130 3300042621 Ga0466729_188994 Ga0466729_188994_564_968 134
131 3300042636 Ga0466703_121629 Ga0466703_121629_180_584 134
132 3300042652 Ga0466708_381916 Ga0466708_381916_28513_28917 134
133 3300002504 JGI24705J35276_12229120 JGI24705J35276_122291203 135
134 3300042615 Ga0466711_058781 Ga0466711_058781_5025_5435 136
135 3300042590 Ga0466690_352947 Ga0466690_352947_6411_6824 137
136 3300042602 Ga0466713_138201 Ga0466713_138201_19937_20350 137
137 3300042606 Ga0466719_127736 Ga0466719_127736_9850_10263 137
138 3300042636 Ga0466703_289947 Ga0466703_289947_5449_5862 137
139 3300042605 Ga0466716_076910 Ga0466716_076910_7997_8413 138
140 3300042615 Ga0466711_025564 Ga0466711_025564_390_806 138
141 3300042615 Ga0466711_443540 Ga0466711_443540_8823_9239 138
142 3300042603 Ga0466714_020508 Ga0466714_020508_1300_1731 143

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01230 HIT HIT domain 11 101 0.93
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 3 103 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01230 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.