Protein Family IF06318

Metagenome Isolate
128 Members
54 Samples
113 Scaffolds
408.66 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_068742|Ga0466716_068742_9732_11417
Length
472 aa
Sequence
MRPGRRSPHNYFESCGRNSPALYARMNFSASSLVIFAQQRTAWHTSSTQNPVFFYAQKALRYDSCLDIINIFANIKFEYINIFMKTNRRDFLKTLGGIAVFTIVPRHVMGKGFIAPSDQLTKGIIGTGGMGRGHLDYAGTRLVAVCDVDKKHLELGKKLVQDKIAAYHDFRDLILDPNVDIVHIATPPHWHGIMSIEAAKAGKDIWCEKPMTRTIGEGKRVTEAVKQYGRMFRLNTWFRFTDTFYGLGTPVKPLKKLVQSGLLGWPLKVTISKHTGFDWKFYWVGKEYLEPQTIPSELDYDLWLGPAPYKDGGGLGDMGQHYIDPVQYFLGKDHTSPVKVEVDAPQQHPDAVGTWRSITYTYEDDCRIILWGGDYGDPATPYISGPNGNVYKNFVCDIPDWEKKLAIECVNTRQPFALNEQNGFRSATIVNMGAVALRLNRTLHFDPVQLEFINDEAANRLSNQPMRSPWNI

📊 Sample Types

Isolate 11.7%
Metagenome 88.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 29.4%
Kalotermitidae 27.5%
Termitidae 17.6%
Termopsidae 7.8%
Unclassified 5.9%
Rhinotermitidae 5.9%
Passalidae 2.0%
Drosophilidae 2.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
2 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
3 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
4 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
12 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
15 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
16 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
17 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
18 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
26 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
27 3004667792 Bacteroides sp. 519 Isolate Blattidae
28 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
29 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
36 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
37 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
41 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
45 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
46 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
47 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
48 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
49 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
50 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
51 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
52 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
53 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
54 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_015262 3300042659 Bacteria 29104
2 Ga0466696_492142 3300042596 Bacteria 89054
3 Ga0160466_100008 3300012809 Bacteria 463729
4 Ga0466711_335686 3300042615 Bacteria 9043
5 Ga0466715_333374 3300042616 Bacteria 37993
6 Ga0466723_046824 3300042618 Bacteria 57163
7 Ga0466723_154223 3300042618 Bacteria 18006
8 Ga0466735_155860 3300042624 Bacteria 1304
9 Ga0466704_229792 3300042643 Bacteria 44121
10 Ga0466708_112792 3300042652 Bacteria 43438
11 Ga0466727_331820 3300042655 Bacteria 4077
12 Ga0466714_077690 3300042603 Bacteria 2366
13 Ga0466714_123157 3300042603 Bacteria 2458
14 Ga0466716_427145 3300042605 Bacteria 20038
15 Ga0466719_033990 3300042606 Bacteria 7178
16 Ga0466722_183602 3300042609 Bacteria 8879
17 JGI24702J35022_10046274 3300002462 Bacteria 2317
18 Ga0068305_10112570 3300005083 Bacteria 4907
19 Ga0466705_180097 3300042612 Bacteria 7156
20 Ga0160453_100001 3300012814 Bacteria 1272344
21 Ga0466691_053160 3300042593 Bacteria 8757
22 Ga0466691_057423 3300042593 Bacteria 8402
23 Ga0466703_049266 3300042636 Bacteria 15884
24 Ga0466703_138224 3300042636 Bacteria 15349
25 Ga0466704_102498 3300042643 Bacteria 21970
26 Ga0466708_077253 3300042652 Bacteria 24343
27 Ga0466716_243171 3300042605 Bacteria 10481
28 Ga0466716_253427 3300042605 Bacteria 6294
29 Ga0466722_022943 3300042609 Bacteria 5625
30 JGI24702J35022_10003336 3300002462 Bacteria 9693
31 Ga0466733_217490 3300042659 Bacteria 17628
32 Ga0466690_030845 3300042590 Bacteria 7785
33 Ga0466694_200522 3300042594 Unclassified 1856
34 Ga0466728_238814 3300042620 Bacteria 13748
35 Ga0466735_114123 3300042624 Bacteria 2123
36 Ga0466735_147422 3300042624 Bacteria 9059
37 Ga0466708_115933 3300042652 Bacteria 26456
38 Ga0466727_164793 3300042655 Unclassified 1972
39 Ga0466707_311289 3300042601 Bacteria 2585
40 Ga0466713_010899 3300042602 Bacteria 25756
41 Ga0466722_066657 3300042609 Bacteria 10498
42 Ga0104045_1003508 3300007085 Bacteria 29645
43 Ga0466733_054986 3300042659 Bacteria 147644
44 Ga0466733_163083 3300042659 Bacteria 18853
45 Ga0466690_202603 3300042590 Bacteria 13450
46 Ga0466693_043257 3300042592 Bacteria 3589
47 Ga0466696_360435 3300042596 Bacteria 8993
48 Ga0123354_10174561 3300010882 Bacteria 2483
49 Ga0466715_357790 3300042616 Bacteria 14955
50 Ga0466715_360583 3300042616 Bacteria 13693
51 Ga0466715_472298 3300042616 Bacteria 24908
52 Ga0466715_591623 3300042616 Bacteria 15648
53 Ga0466723_034385 3300042618 Bacteria 31971
54 Ga0466723_272864 3300042618 Unclassified 6802
55 Ga0466726_438807 3300042619 Bacteria 3372
56 Ga0466735_077407 3300042624 Bacteria 2221
57 Ga0466714_012705 3300042603 Bacteria 2737
58 IMNBL1DRAFT_c0002541 3300000062 Bacteria 12608
59 Ga0466705_249881 3300042612 Unclassified 2822
60 Ga0466733_221141 3300042659 Bacteria 323281
61 Ga0466692_120939 3300042591 Bacteria 20322
62 Ga0466694_347426 3300042594 Bacteria 1441
63 Ga0466711_187042 3300042615 Bacteria 8533
64 Ga0466706_111295 3300042599 Bacteria 12938
65 Ga0466707_062254 3300042601 Bacteria 4954
66 Ga0466707_099354 3300042601 Bacteria 12143
67 Ga0466719_231193 3300042606 Bacteria 4125
68 JGI24702J35022_10000173 3300002462 Bacteria 33823
69 Ga0466692_165599 3300042591 Bacteria 54055
70 Ga0466694_370682 3300042594 Unclassified 2948
71 Ga0123353_10064311 3300010167 Unclassified 5886
72 Ga0466711_191912 3300042615 Bacteria 7708
73 Ga0466711_238034 3300042615 Bacteria 37187
74 Ga0466715_465245 3300042616 Bacteria 8266
75 Ga0466723_318669 3300042618 Bacteria 11246
76 Ga0466729_121703 3300042621 Bacteria 15107
77 Ga0466729_177429 3300042621 Bacteria 1192
78 Ga0466709_218820 3300042648 Bacteria 3686
79 Ga0466724_58157 3300042649 Bacteria 32184
80 Ga0466707_269407 3300042601 Bacteria 19464
81 IMNBL1DRAFT_c0010396 3300000062 Bacteria 4462
82 JGI24705J35276_12238552 3300002504 Bacteria 26267
83 Ga0466705_207794 3300042612 Bacteria 20507
84 Ga0466693_442265 3300042592 Bacteria 1158
85 Ga0466696_203426 3300042596 Bacteria 19268
86 Ga0466726_081459 3300042619 Bacteria 10119
87 Ga0466726_228641 3300042619 Bacteria 3204
88 Ga0466726_442653 3300042619 Unclassified 2364
89 Ga0466735_024329 3300042624 Bacteria 1608
90 Ga0466735_092752 3300042624 Bacteria 6044
91 Ga0466727_088458 3300042655 Bacteria 14738
92 Ga0466727_168085 3300042655 Bacteria 6022
93 Ga0466727_228417 3300042655 Bacteria 24521
94 Ga0466707_123449 3300042601 Bacteria 5903
95 Ga0466707_216781 3300042601 Bacteria 19756
96 Ga0466713_068788 3300042602 Bacteria 21856
97 Ga0466716_068742 3300042605 Bacteria 11694
98 Ga0466716_216590 3300042605 Bacteria 14194
99 Ga0068302_10122751 3300005071 Bacteria 9629
100 Ga0068305_10012806 3300005083 Bacteria 11631
101 Ga0265387_1000345 3300024582 Bacteria 7690
102 Ga0466715_170213 3300042616 Bacteria 11367
103 Ga0466715_404217 3300042616 Bacteria 4004
104 Ga0466729_146615 3300042621 Bacteria 2931
105 Ga0466703_138518 3300042636 Bacteria 20083
106 Ga0466703_303645 3300042636 Bacteria 5499
107 Ga0466703_378412 3300042636 Bacteria 12961
108 Ga0466704_078614 3300042643 Bacteria 12503
109 Ga0466704_125985 3300042643 Bacteria 4564
110 Ga0466704_174504 3300042643 Bacteria 9220
111 Ga0466704_479980 3300042643 Bacteria 5894
112 Ga0466727_021926 3300042655 Bacteria 50464
113 Ga0466727_064705 3300042655 Bacteria 4314

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_024329 Ga0466735_024329_528_1592 345
2 3300042594 Ga0466694_200522 Ga0466694_200522_31_1074 347
3 3300042601 Ga0466707_216781 Ga0466707_216781_17598_18716 356
4 3300042592 Ga0466693_442265 Ga0466693_442265_20_1108 362
5 3300042624 Ga0466735_092752 Ga0466735_092752_4669_5892 375
6 3300042621 Ga0466729_177429 Ga0466729_177429_14_1162 382
7 3300042603 Ga0466714_012705 Ga0466714_012705_1216_2466 386
8 3300042615 Ga0466711_335686 Ga0466711_335686_5983_7239 386
9 3300042618 Ga0466723_272864 Ga0466723_272864_3668_4924 389
10 3300042616 Ga0466715_591623 Ga0466715_591623_672_1895 390
11 3300042601 Ga0466707_269407 Ga0466707_269407_5310_6566 393
12 3300042602 Ga0466713_010899 Ga0466713_010899_16165_17418 393
13 3300042624 Ga0466735_155860 Ga0466735_155860_48_1262 393
14 3300005083 Ga0068305_10012806 Ga0068305_100128063 394
15 3300042605 Ga0466716_243171 Ga0466716_243171_8970_10226 397
16 3300042655 Ga0466727_064705 Ga0466727_064705_169_1425 397
17 3300042593 Ga0466691_057423 Ga0466691_057423_709_1932 398
18 3300042616 Ga0466715_472298 Ga0466715_472298_13391_14647 398
19 3300042618 Ga0466723_046824 Ga0466723_046824_15361_16584 398
20 3300042636 Ga0466703_303645 Ga0466703_303645_14_1237 399
21 3300042659 Ga0466733_217490 Ga0466733_217490_11054_12304 399
22 3300042616 Ga0466715_333374 Ga0466715_333374_19111_20367 400
23 3300042593 Ga0466691_053160 Ga0466691_053160_6938_8194 401
24 3300042601 Ga0466707_099354 Ga0466707_099354_7165_8421 401
25 3300042609 Ga0466722_066657 Ga0466722_066657_4131_5387 401
26 3300042612 Ga0466705_180097 Ga0466705_180097_5363_6619 401
27 3300042612 Ga0466705_207794 Ga0466705_207794_10868_12124 401
28 3300042615 Ga0466711_238034 Ga0466711_238034_28722_29978 401
29 3300042616 Ga0466715_357790 Ga0466715_357790_5866_7122 401
30 3300042619 Ga0466726_442653 Ga0466726_442653_193_1449 401
31 3300042624 Ga0466735_147422 Ga0466735_147422_2077_3333 401
32 3300042636 Ga0466703_138224 Ga0466703_138224_3322_4578 401
33 3300042636 Ga0466703_378412 Ga0466703_378412_2019_3275 401
34 3300042643 Ga0466704_078614 Ga0466704_078614_9371_10627 401
35 3300042643 Ga0466704_102498 Ga0466704_102498_12870_14126 401
36 3300002462 JGI24702J35022_10046274 JGI24702J35022_100462742 402
37 3300005083 Ga0068305_10112570 Ga0068305_101125701 402
38 3300010167 Ga0123353_10064311 Ga0123353_100643115 402
39 3300010882 Ga0123354_10174561 Ga0123354_101745611 402
40 3300042590 Ga0466690_202603 Ga0466690_202603_6221_7477 402
41 3300042621 Ga0466729_146615 Ga0466729_146615_76_1332 402
42 3300042636 Ga0466703_138518 Ga0466703_138518_1408_2664 402
43 3300042648 Ga0466709_218820 Ga0466709_218820_1812_3068 402
44 3300042594 Ga0466694_370682 Ga0466694_370682_861_2117 404
45 3300042601 Ga0466707_311289 Ga0466707_311289_1211_2467 404
46 3300042621 Ga0466729_121703 Ga0466729_121703_12579_13835 404
47 3300042624 Ga0466735_114123 Ga0466735_114123_82_1338 404
48 3300042643 Ga0466704_229792 Ga0466704_229792_38732_39988 404
49 3300042652 Ga0466708_112792 Ga0466708_112792_37962_39218 404
50 3300042655 Ga0466727_088458 Ga0466727_088458_3448_4704 404
51 3300002504 JGI24705J35276_12238552 JGI24705J35276_1223855219 405
52 3300042643 Ga0466704_174504 Ga0466704_174504_3764_5020 405
53 3300042659 Ga0466733_221141 Ga0466733_221141_39584_40855 405
54 3300042596 Ga0466696_492142 Ga0466696_492142_74733_75989 406
55 3300042605 Ga0466716_427145 Ga0466716_427145_2432_3688 406
56 3300042619 Ga0466726_228641 Ga0466726_228641_1765_3021 406
57 3300042596 Ga0466696_203426 Ga0466696_203426_3370_4593 407
58 3300042603 Ga0466714_077690 Ga0466714_077690_253_1503 407
59 3300042609 Ga0466722_183602 Ga0466722_183602_977_2236 407
60 3300042616 Ga0466715_170213 Ga0466715_170213_636_1886 407
61 3300042618 Ga0466723_034385 Ga0466723_034385_6322_7593 407
62 3300042618 Ga0466723_318669 Ga0466723_318669_6357_7607 407
63 3300042655 Ga0466727_164793 Ga0466727_164793_129_1352 407
64 3300042605 Ga0466716_253427 Ga0466716_253427_107_1360 408
65 3300042590 Ga0466690_030845 Ga0466690_030845_5721_6977 409
66 3300042655 Ga0466727_331820 Ga0466727_331820_1685_2944 409
67 3300042659 Ga0466733_163083 Ga0466733_163083_3200_4456 409
68 3300000062 IMNBL1DRAFT_c0002541 IMNBL1DRAFT_00025413 410
69 3300042606 Ga0466719_033990 Ga0466719_033990_5243_6499 410
70 3300042659 Ga0466733_054986 Ga0466733_054986_132470_133741 410
71 3300042624 Ga0466735_077407 Ga0466735_077407_646_1902 411
72 3300042659 Ga0466733_015262 Ga0466733_015262_25929_27182 411
73 3300042649 Ga0466724_58157 Ga0466724_58157_7439_8707 412
74 3300042601 Ga0466707_123449 Ga0466707_123449_1198_2472 415
75 3300005071 Ga0068302_10122751 Ga0068302_101227512 416
76 3300042605 Ga0466716_216590 Ga0466716_216590_3008_4258 416
77 3300042612 Ga0466705_249881 Ga0466705_249881_466_1716 416
78 3300042616 Ga0466715_465245 Ga0466715_465245_1662_2912 416
79 3300042643 Ga0466704_479980 Ga0466704_479980_4607_5857 416
80 3300042652 Ga0466708_115933 Ga0466708_115933_2130_3380 416
81 3300042609 Ga0466722_022943 Ga0466722_022943_630_1886 418
82 3300042615 Ga0466711_187042 Ga0466711_187042_166_1422 418
83 3300042615 Ga0466711_191912 Ga0466711_191912_2532_3788 418
84 3300042616 Ga0466715_360583 Ga0466715_360583_3994_5250 418
85 3300042616 Ga0466715_404217 Ga0466715_404217_1089_2345 418
86 3300042618 Ga0466723_154223 Ga0466723_154223_14009_15265 418
87 3300042619 Ga0466726_438807 Ga0466726_438807_330_1586 418
88 3300042620 Ga0466728_238814 Ga0466728_238814_5294_6550 418
89 3300042643 Ga0466704_125985 Ga0466704_125985_1714_2970 418
90 3300042652 Ga0466708_077253 Ga0466708_077253_18103_19359 418
91 3300042655 Ga0466727_168085 Ga0466727_168085_4570_5826 418
92 3300042655 Ga0466727_228417 Ga0466727_228417_15243_16499 418
93 iso_pr_bacteria 2940195863 2940196196 418
94 iso_pr_bacteria 2940202316 2940205382 418
95 iso_pr_bacteria 2940205530 2940206724 418
96 iso_pr_bacteria 2940212447 2940213575 418
97 iso_pr_bacteria 2940298504 2940299629 418
98 iso_pr_bacteria 2940302308 2940303500 418
99 iso_pr_bacteria 2940306115 2940307520 418
100 iso_pr_bacteria 2940309933 2940311054 418
101 iso_pr_bacteria 2940313741 2940314802 418
102 iso_pr_bacteria 2940317558 2940318617 418
103 iso_pr_bacteria 2940321370 2940322492 418
104 iso_pr_bacteria 2940325180 2940326308 418
105 iso_pr_bacteria 2940328985 2940330114 418
106 iso_pr_bacteria 2940332795 2940333918 418
107 iso_pr_bacteria 3004667792 3004670932 418
108 3300000062 IMNBL1DRAFT_c0010396 IMNBL1DRAFT_00103962 419
109 3300042591 Ga0466692_120939 Ga0466692_120939_336_1595 419
110 3300042591 Ga0466692_165599 Ga0466692_165599_18433_19692 419
111 3300002462 JGI24702J35022_10000173 JGI24702J35022_100001735 420
112 3300024582 Ga0265387_1000345 Ga0265387_10003455 421
113 3300042601 Ga0466707_062254 Ga0466707_062254_1034_2323 421
114 3300042596 Ga0466696_360435 Ga0466696_360435_4530_5798 422
115 3300012809 Ga0160466_100008 Ga0160466_10000819 423
116 3300012814 Ga0160453_100001 Ga0160453_100001916 423
117 3300042599 Ga0466706_111295 Ga0466706_111295_3818_5095 425
118 3300042602 Ga0466713_068788 Ga0466713_068788_10567_11937 425
119 3300042606 Ga0466719_231193 Ga0466719_231193_1474_2754 426
120 3300042636 Ga0466703_049266 Ga0466703_049266_3121_4407 428
121 3300042603 Ga0466714_123157 Ga0466714_123157_577_1869 430
122 3300042619 Ga0466726_081459 Ga0466726_081459_3549_4871 431
123 3300042655 Ga0466727_021926 Ga0466727_021926_23070_24392 431
124 3300002462 JGI24702J35022_10003336 JGI24702J35022_100033366 432
125 3300042594 Ga0466694_347426 Ga0466694_347426_51_1349 432
126 3300042592 Ga0466693_043257 Ga0466693_043257_1894_3207 437
127 3300007085 Ga0104045_1003508 Ga0104045_100350811 440
128 3300042605 Ga0466716_068742 Ga0466716_068742_9732_11417 472

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19051 GFO_IDH_MocA_C2 Oxidoreductase family, C-terminal alpha/beta domain 247 472 0.98
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 123 234 0.88
PF22725 GFO_IDH_MocA_C3 GFO/IDH/MocA C-terminal domain 254 371 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01408 GO:0000166 nucleotide binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.58 0.69 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.