Protein Family IF06315

Metagenome Isolate
123 Members
54 Samples
106 Scaffolds
363.74 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_060526|Ga0466716_060526_5312_6544
Length
410 aa
Sequence
MCNSSKILSANKNGSTLFTAENILGKKTESKIGDEENKYHNIMKKIRLFPLLTFICALSGISILSQAQNNQPLRLGVAGLSHGHLWEVVRRADRGDFVIVGVAEKDSLLRAANRLRDKIDASLFYADLEEMLDRAKPEAVIVYESIYDHLRVVELCAPRGIHVMVEKPLAVNMEHAERMAELAKKHKIHLLTNYETTWYNTNHEACGLIREGAIGNITRINVYDGHQGPFEIGCGKEFTDWLTDPVLNGGGAVIDFGCYGANLATWLLKGEKPKCVYGILKQQKPDKYPEVDDDATIIIEYPSAVVQIMASWNWPMNRKDMHIYGSKGYIYQDTPSKMRVYAGQKETTVEPPSLIAPYNDAFYYLKAVVRNEIQMEPYDLSSLENNLWVVRILEAAVKSSESGKIIYFGN

📊 Sample Types

Isolate 13.8%
Metagenome 86.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 25.9%
Kalotermitidae 24.1%
Termitidae 22.2%
Rhinotermitidae 7.4%
Termopsidae 7.4%
Hydrophilidae 3.7%
Passalidae 3.7%
Unclassified 3.7%
Formicidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
2 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
3 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
11 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
20 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
21 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
22 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
23 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
24 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
25 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
26 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
39 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
40 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
41 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
42 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
43 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
44 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
45 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
50 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
51 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_219490 3300042611 Bacteria 2306
2 Ga0466705_073835 3300042612 Bacteria 13642
3 Ga0466733_156198 3300042659 Bacteria 2559
4 Ga0466726_299490 3300042619 Bacteria 1841
5 Ga0466726_468394 3300042619 Bacteria 5774
6 Ga0123356_10303996 3300010049 Bacteria 1701
7 Ga0466693_060925 3300042592 Bacteria 1934
8 Ga0466703_113650 3300042636 Bacteria 1153
9 Ga0466703_162329 3300042636 Bacteria 4587
10 Ga0466703_393906 3300042636 Bacteria 3848
11 Ga0466727_197256 3300042655 Bacteria 9258
12 JGI24702J35022_10002198 3300002462 Bacteria 12011
13 Ga0068302_10231708 3300005071 Bacteria 4079
14 Ga0466705_310551 3300042612 Unclassified 1879
15 Ga0466733_156258 3300042659 Bacteria 22768
16 Ga0466707_038134 3300042601 Bacteria 3102
17 Ga0466713_122827 3300042602 Bacteria 174567
18 Ga0466716_060526 3300042605 Bacteria 11534
19 Ga0466722_046516 3300042609 Bacteria 10066
20 Ga0466715_351050 3300042616 Bacteria 23393
21 Ga0466691_049840 3300042593 Bacteria 5625
22 Ga0466694_373091 3300042594 Bacteria 3319
23 Ga0466696_278891 3300042596 Bacteria 171866
24 Ga0466729_298133 3300042621 Unclassified 1994
25 Ga0466735_137502 3300042624 Bacteria 1932
26 Ga0466704_237387 3300042643 Unclassified 5378
27 Ga0466709_242055 3300042648 Bacteria 39824
28 Ga0466708_189255 3300042652 Bacteria 25954
29 Ga0466733_024002 3300042659 Bacteria 39250
30 Ga0466733_061780 3300042659 Bacteria 7829
31 Ga0466716_101111 3300042605 Bacteria 10329
32 Ga0466722_007565 3300042609 Bacteria 18233
33 Ga0466722_020017 3300042609 Bacteria 34997
34 Ga0466726_235413 3300042619 Bacteria 13638
35 Ga0466728_407126 3300042620 Bacteria 2184
36 Ga0466690_257044 3300042590 Bacteria 11658
37 Ga0466691_055328 3300042593 Bacteria 16815
38 Ga0466696_307254 3300042596 Bacteria 3102
39 Ga0466703_169714 3300042636 Bacteria 1626
40 Ga0466704_120171 3300042643 Bacteria 7058
41 2227469648 2225789004 Unclassified 4959
42 JGI24705J35276_12238381 3300002504 Bacteria 20559
43 Ga0466705_229291 3300042612 Bacteria 5475
44 Ga0466733_034514 3300042659 Bacteria 7197
45 Ga0466722_222149 3300042609 Bacteria 29587
46 Ga0466711_193024 3300042615 Bacteria 1549
47 Ga0123356_10015619 3300010049 Bacteria 7272
48 Ga0123353_10336808 3300010167 Bacteria 2281
49 Ga0466730_090213 3300042625 Bacteria 3971
50 Ga0466703_170192 3300042636 Bacteria 2927
51 Ga0466704_066547 3300042643 Bacteria 4899
52 Ga0466704_313163 3300042643 Bacteria 12079
53 IMNBL1DRAFT_c0000971 3300000062 Bacteria 22123
54 Ga0466700_044544 3300042600 Bacteria 6401
55 Ga0466713_109231 3300042602 Bacteria 188899
56 Ga0466714_035793 3300042603 Bacteria 2068
57 Ga0466718_098654 3300042617 Bacteria 2909
58 Ga0466729_170843 3300042621 Bacteria 4227
59 Ga0466690_161469 3300042590 Bacteria 6450
60 Ga0466692_160817 3300042591 Unclassified 1293
61 Ga0466696_350305 3300042596 Bacteria 9326
62 Ga0466703_203837 3300042636 Bacteria 13462
63 Ga0466704_300355 3300042643 Bacteria 9268
64 Ga0466704_445353 3300042643 Bacteria 16743
65 Ga0466727_159237 3300042655 Bacteria 9407
66 IMNBL1DRAFT_c0004012 3300000062 Bacteria 9064
67 Ga0466705_084835 3300042612 Bacteria 10230
68 Ga0466733_217788 3300042659 Bacteria 53499
69 Ga0466713_040834 3300042602 Bacteria 17557
70 Ga0466719_290663 3300042606 Unclassified 2861
71 Ga0466711_215795 3300042615 Bacteria 6141
72 Ga0466715_195380 3300042616 Bacteria 5150
73 Ga0466728_191258 3300042620 Bacteria 7033
74 Ga0466729_189743 3300042621 Bacteria 5233
75 Ga0466692_063390 3300042591 Bacteria 95171
76 Ga0466735_080909 3300042624 Bacteria 4736
77 Ga0466704_043162 3300042643 Bacteria 9716
78 Ga0466704_434542 3300042643 Bacteria 4792
79 Ga0466704_503296 3300042643 Unclassified 3375
80 Ga0466708_021896 3300042652 Bacteria 36089
81 Ga0466705_077431 3300042612 Bacteria 39083
82 Ga0466733_038274 3300042659 Bacteria 12107
83 Ga0466713_148662 3300042602 Bacteria 25209
84 Ga0466714_049830 3300042603 Bacteria 6027
85 Ga0466714_096645 3300042603 Bacteria 2061
86 Ga0466722_041164 3300042609 Bacteria 8947
87 Ga0466711_158971 3300042615 Bacteria 32433
88 Ga0466715_063927 3300042616 Bacteria 20242
89 Ga0466729_020123 3300042621 Bacteria 18252
90 Ga0466703_076131 3300042636 Bacteria 4530
91 Ga0466703_247130 3300042636 Bacteria 5554
92 Ga0466709_221215 3300042648 Bacteria 16956
93 Ga0466709_362123 3300042648 Bacteria 19052
94 JGI24702J35022_10001384 3300002462 Bacteria 15078
95 Ga0068302_10034096 3300005071 Unclassified 3112
96 Ga0466733_073972 3300042659 Bacteria 2956
97 Ga0466713_100016 3300042602 Bacteria 46673
98 Ga0466692_037359 3300042591 Bacteria 23412
99 Ga0466692_172974 3300042591 Bacteria 1066
100 Ga0466735_084851 3300042624 Bacteria 3169
101 Ga0466703_190015 3300042636 Bacteria 11527
102 Ga0466703_230908 3300042636 Bacteria 6863
103 Ga0466704_064342 3300042643 Bacteria 12076
104 Ga0466704_405992 3300042643 Bacteria 30758
105 Ga0466727_087033 3300042655 Bacteria 10438
106 Ga0102740_1001647 3300007140 Bacteria 5502

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_310551 Ga0466705_310551_815_1810 331
2 3300042594 Ga0466694_373091 Ga0466694_373091_1562_2566 334
3 3300042591 Ga0466692_172974 Ga0466692_172974_15_1022 335
4 3300042609 Ga0466722_046516 Ga0466722_046516_2952_4052 342
5 3300042619 Ga0466726_468394 Ga0466726_468394_3575_4606 343
6 3300042620 Ga0466728_407126 Ga0466728_407126_34_1068 344
7 3300042591 Ga0466692_160817 Ga0466692_160817_173_1264 345
8 3300042592 Ga0466693_060925 Ga0466693_060925_662_1699 345
9 3300042659 Ga0466733_217788 Ga0466733_217788_31860_32960 345
10 3300005071 Ga0068302_10034096 Ga0068302_100340963 348
11 3300042606 Ga0466719_290663 Ga0466719_290663_203_1252 349
12 3300042636 Ga0466703_076131 Ga0466703_076131_693_1742 349
13 3300042619 Ga0466726_235413 Ga0466726_235413_4894_5946 350
14 2225789004 2227469648 2227913711 351
15 3300042609 Ga0466722_020017 Ga0466722_020017_29612_30712 352
16 3300042655 Ga0466727_159237 Ga0466727_159237_7627_8685 352
17 3300000062 IMNBL1DRAFT_c0000971 IMNBL1DRAFT_00009714 355
18 3300042636 Ga0466703_169714 Ga0466703_169714_475_1599 355
19 3300042602 Ga0466713_100016 Ga0466713_100016_312_1403 356
20 3300042609 Ga0466722_222149 Ga0466722_222149_11901_12971 356
21 3300042648 Ga0466709_242055 Ga0466709_242055_192_1283 356
22 3300042636 Ga0466703_393906 Ga0466703_393906_2007_3104 357
23 3300042603 Ga0466714_049830 Ga0466714_049830_3536_4615 359
24 3300042615 Ga0466711_215795 Ga0466711_215795_4640_5719 359
25 3300042591 Ga0466692_063390 Ga0466692_063390_35367_36449 360
26 3300042659 Ga0466733_073972 Ga0466733_073972_1652_2734 360
27 3300042603 Ga0466714_096645 Ga0466714_096645_519_1604 361
28 3300042612 Ga0466705_229291 Ga0466705_229291_794_1879 361
29 3300042596 Ga0466696_278891 Ga0466696_278891_164233_165321 362
30 3300042596 Ga0466696_307254 Ga0466696_307254_780_1868 362
31 3300042603 Ga0466714_035793 Ga0466714_035793_462_1550 362
32 3300042609 Ga0466722_007565 Ga0466722_007565_5872_6960 362
33 3300042612 Ga0466705_077431 Ga0466705_077431_16018_17106 362
34 3300042620 Ga0466728_191258 Ga0466728_191258_5803_6891 362
35 3300042621 Ga0466729_170843 Ga0466729_170843_298_1386 362
36 3300042643 Ga0466704_313163 Ga0466704_313163_984_2072 362
37 3300042643 Ga0466704_434542 Ga0466704_434542_2710_3798 362
38 3300042648 Ga0466709_221215 Ga0466709_221215_7310_8398 362
39 3300042659 Ga0466733_024002 Ga0466733_024002_1836_2924 362
40 3300042591 Ga0466692_037359 Ga0466692_037359_1233_2324 363
41 3300042602 Ga0466713_148662 Ga0466713_148662_3838_4929 363
42 3300042624 Ga0466735_080909 Ga0466735_080909_499_1590 363
43 3300042643 Ga0466704_043162 Ga0466704_043162_7658_8749 363
44 3300042643 Ga0466704_066547 Ga0466704_066547_2854_3945 363
45 iso_pr_bacteria 8100166142 8100170008 363
46 3300042601 Ga0466707_038134 Ga0466707_038134_1750_2844 364
47 3300042602 Ga0466713_109231 Ga0466713_109231_109847_110941 364
48 3300042612 Ga0466705_084835 Ga0466705_084835_8920_10014 364
49 3300042619 Ga0466726_299490 Ga0466726_299490_466_1560 364
50 3300042621 Ga0466729_298133 Ga0466729_298133_33_1127 364
51 iso_pr_bacteria 2910942425 2910945617 364
52 iso_pr_bacteria 2940205530 2940205896 364
53 iso_pr_bacteria 2940212447 2940212811 364
54 iso_pr_bacteria 2940298504 2940298868 364
55 iso_pr_bacteria 2940302308 2940302672 364
56 iso_pr_bacteria 2940306115 2940309220 364
57 iso_pr_bacteria 2940309933 2940313057 364
58 iso_pr_bacteria 2940313741 2940316871 364
59 iso_pr_bacteria 2940317558 2940320685 364
60 iso_pr_bacteria 2940321370 2940324442 364
61 iso_pr_bacteria 2940325180 2940325212 364
62 iso_pr_bacteria 2940328985 2940329017 364
63 iso_pr_bacteria 2940332795 2940335923 364
64 3300010049 Ga0123356_10303996 Ga0123356_103039963 365
65 3300042596 Ga0466696_350305 Ga0466696_350305_4313_5410 365
66 3300042605 Ga0466716_101111 Ga0466716_101111_5288_6385 365
67 3300042615 Ga0466711_158971 Ga0466711_158971_22332_23429 365
68 3300042621 Ga0466729_020123 Ga0466729_020123_16439_17536 365
69 3300042625 Ga0466730_090213 Ga0466730_090213_2701_3798 365
70 3300042636 Ga0466703_230908 Ga0466703_230908_1366_2463 365
71 3300042652 Ga0466708_021896 Ga0466708_021896_11727_12824 365
72 3300042659 Ga0466733_038274 Ga0466733_038274_264_1361 365
73 3300042659 Ga0466733_061780 Ga0466733_061780_819_1916 365
74 3300042659 Ga0466733_156198 Ga0466733_156198_139_1236 365
75 3300002504 JGI24705J35276_12238381 JGI24705J35276_122383818 366
76 3300042602 Ga0466713_040834 Ga0466713_040834_2997_4097 366
77 3300042636 Ga0466703_113650 Ga0466703_113650_17_1117 366
78 3300042636 Ga0466703_162329 Ga0466703_162329_554_1654 366
79 3300042636 Ga0466703_170192 Ga0466703_170192_1625_2725 366
80 3300042643 Ga0466704_445353 Ga0466704_445353_14637_15737 366
81 3300042655 Ga0466727_087033 Ga0466727_087033_548_1648 366
82 3300042659 Ga0466733_034514 Ga0466733_034514_772_1872 366
83 3300000062 IMNBL1DRAFT_c0004012 IMNBL1DRAFT_00040123 367
84 3300005071 Ga0068302_10231708 Ga0068302_102317081 367
85 3300007140 Ga0102740_1001647 Ga0102740_10016473 367
86 3300042593 Ga0466691_055328 Ga0466691_055328_2378_3481 367
87 3300042600 Ga0466700_044544 Ga0466700_044544_5110_6213 367
88 3300042609 Ga0466722_041164 Ga0466722_041164_3049_4152 367
89 3300042611 Ga0466697_219490 Ga0466697_219490_795_1898 367
90 3300042615 Ga0466711_193024 Ga0466711_193024_303_1406 367
91 3300042616 Ga0466715_063927 Ga0466715_063927_18810_19913 367
92 3300042616 Ga0466715_195380 Ga0466715_195380_2957_4060 367
93 3300042616 Ga0466715_351050 Ga0466715_351050_21315_22418 367
94 3300042621 Ga0466729_189743 Ga0466729_189743_3233_4336 367
95 3300042648 Ga0466709_362123 Ga0466709_362123_11046_12149 367
96 3300042659 Ga0466733_156258 Ga0466733_156258_17243_18346 367
97 iso_pr_bacteria 2940195863 2940196987 367
98 3300002462 JGI24702J35022_10002198 JGI24702J35022_100021988 368
99 3300042590 Ga0466690_161469 Ga0466690_161469_4172_5278 368
100 3300042612 Ga0466705_073835 Ga0466705_073835_257_1363 368
101 3300042624 Ga0466735_084851 Ga0466735_084851_1027_2133 368
102 3300042643 Ga0466704_064342 Ga0466704_064342_9411_10517 368
103 3300042643 Ga0466704_120171 Ga0466704_120171_1165_2271 368
104 3300042643 Ga0466704_503296 Ga0466704_503296_492_1598 368
105 3300042652 Ga0466708_189255 Ga0466708_189255_16152_17258 368
106 3300042602 Ga0466713_122827 Ga0466713_122827_158021_159130 369
107 3300042636 Ga0466703_190015 Ga0466703_190015_205_1314 369
108 3300042636 Ga0466703_247130 Ga0466703_247130_1384_2493 369
109 3300042643 Ga0466704_300355 Ga0466704_300355_7737_8846 369
110 iso_pr_bacteria 2873600114 2873602240 369
111 iso_pr_bacteria 2873610414 2873612605 369
112 3300010049 Ga0123356_10015619 Ga0123356_100156195 371
113 3300042593 Ga0466691_049840 Ga0466691_049840_3058_4173 371
114 3300042655 Ga0466727_197256 Ga0466727_197256_7785_8903 372
115 3300042643 Ga0466704_405992 Ga0466704_405992_13042_14163 373
116 3300042624 Ga0466735_137502 Ga0466735_137502_702_1829 375
117 3300042636 Ga0466703_203837 Ga0466703_203837_676_1809 377
118 3300042643 Ga0466704_237387 Ga0466704_237387_2313_3449 378
119 3300002462 JGI24702J35022_10001384 JGI24702J35022_100013843 382
120 3300042617 Ga0466718_098654 Ga0466718_098654_1157_2332 391
121 3300010167 Ga0123353_10336808 Ga0123353_103368082 404
122 3300042590 Ga0466690_257044 Ga0466690_257044_356_1582 408
123 3300042605 Ga0466716_060526 Ga0466716_060526_5312_6544 410

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22725 GFO_IDH_MocA_C3 GFO/IDH/MocA C-terminal domain 207 330 0.95
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 208 404 0.83
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 98 191 0.81

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01408 GO:0000166 nucleotide binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.