Protein Family IF06289

Metagenome Isolate
168 Members
110 Samples
124 Scaffolds
210.62 Avg Length

🧬 Representative Sequence

ID
3300042604|Ga0466717_296892|Ga0466717_296892_4310_4981
Length
223 aa
Sequence
LNDASEIFVKETTMKLWSNSFTNLNLIPGEYAFCVIDATHHVALSGNRNPHLAWSEAPPNTQSFVLICYDKDVPSRGDDVNKEDREVPASLPRVDFFHWVLIDIPAAQREIEAGSYSHGVTARGKPEVLPALGNMRHGINDYTSWFAGDAEMRGDYYGYDGPCPPWNDSIVHQYIFTLYALDVPRLRVDGQLSGQAVRLAMQKYILAQASLMGLYTLNPRLAK

📊 Sample Types

Isolate 26.2%
Metagenome 73.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 16.4%
Unclassified 13.6%
Anthocoridae 11.8%
Formicidae 11.8%
Kalotermitidae 10.0%
Culicidae 8.2%
Curculionidae 6.4%
Elmidae 6.4%
Drosophilidae 5.5%
Rhinotermitidae 1.8%
Apidae 1.8%
Armadillidiidae 1.8%
Termopsidae 1.8%
Passalidae 0.9%
Crambidae 0.9%
Alydidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 151
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
2 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
3 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
4 2864937364 Acidovorax soli S00198 Isolate Elmidae
5 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
6 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
7 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
8 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
9 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
10 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
11 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
12 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
13 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
14 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
15 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
16 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
21 8100455565 Delftia sp. S67 Isolate Curculionidae
22 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
23 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
28 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
29 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
30 2820951912 Unclassified Acidobacteria Emb289P4bin26 Isolate Unclassified
31 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
32 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
33 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
34 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
35 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
36 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
37 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
38 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
41 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
42 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
43 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
44 2978161719 Serratia marcescens KZ2 Isolate Apidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
47 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
48 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
49 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
50 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
51 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
52 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
53 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
54 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
55 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
56 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
57 3300007088 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut Metagenome Drosophilidae
58 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
59 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
60 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
61 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
62 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
63 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
64 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
65 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
66 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
67 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
68 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
69 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
70 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
71 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
72 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
73 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
74 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
75 8100449422 Delftia sp. S66 Isolate Curculionidae
76 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
77 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
78 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
79 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
80 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
81 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
82 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
83 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
84 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
85 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
86 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
87 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
88 2937735258 Serratia marcescens KZ11 Isolate Apidae
89 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
90 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
91 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
92 8100461708 Delftia sp. S65 Isolate Curculionidae
93 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
94 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
95 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
96 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
97 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
98 2603880165 Burkholderiales A1 Isolate Unclassified
99 2603880170 Burkholderiales A2 Isolate Unclassified
100 2603880172 Burkholderiales C Isolate Unclassified
101 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
102 8103002986 Erwinia sp. S38 Isolate Curculionidae
103 8103008710 Erwinia sp. S43 Isolate Curculionidae
104 3300005306 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 1 gut Metagenome Drosophilidae
105 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
106 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
107 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
108 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
109 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
110 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_350039 3300042612 Bacteria 3378
2 Ga0466710_067864 3300042613 Bacteria 3864
3 Ga0466711_115466 3300042615 Bacteria 7970
4 Ga0160446_101748 3300012835 Bacteria 4280
5 Ga0160435_1000212 3300012857 Bacteria 28327
6 Ga0466694_377649 3300042594 Bacteria 9090
7 Ga0466734_162035 3300042623 Bacteria 16770
8 Ga0466704_288860 3300042643 Bacteria 2212
9 Ga0466727_143538 3300042655 Bacteria 3953
10 Ga0466717_296892 3300042604 Bacteria 6211
11 DPO_contig00424 2032320009 Bacteria 23497
12 Ga0103261_1003499 3300007083 Bacteria 2430
13 Ga0103260_1000990 3300007139 Bacteria 5235
14 Ga0102740_1002268 3300007140 Unclassified 4476
15 Ga0102737_1002340 3300007142 Bacteria 4754
16 Ga0103264_1000510 3300007188 Bacteria 36323
17 Ga0466733_055935 3300042659 Bacteria 2040
18 Ga0466710_039713 3300042613 Bacteria 2625
19 Ga0466726_021117 3300042619 Bacteria 4960
20 Ga0466690_121661 3300042590 Bacteria 3056
21 Ga0466692_101940 3300042591 Bacteria 50488
22 Ga0466696_036930 3300042596 Bacteria 6923
23 Ga0466696_134534 3300042596 Bacteria 3065
24 Ga0466701_005129 3300042598 Bacteria 3392
25 Ga0123354_10000024 3300010882 Bacteria 118691
26 Ga0123354_10099949 3300010882 Bacteria 3931
27 Ga0466724_37273 3300042649 Bacteria 1340
28 Ga0466701_025431 3300042598 Unclassified 1549
29 Ga0466697_031615 3300042611 Bacteria 2544
30 CVPL005W_1000027 3300002934 Bacteria 52318
31 Ga0103261_1000985 3300007083 Bacteria 4449
32 Ga0103264_1025441 3300007188 Bacteria 2807
33 Ga0103264_1040311 3300007188 Bacteria 1996
34 Ga0466705_179154 3300042612 Bacteria 1025
35 Ga0466723_039361 3300042618 Unclassified 3808
36 Ga0160472_103698 3300012839 Bacteria 2927
37 Ga0160460_100364 3300012845 Bacteria 30732
38 Ga0160447_100740 3300012849 Bacteria 14113
39 Ga0466693_181172 3300042592 Bacteria 3255
40 Ga0466734_010742 3300042623 Bacteria 3748
41 Ga0466730_001347 3300042625 Unclassified 34704
42 Ga0466704_014985 3300042643 Bacteria 7420
43 Ga0466725_285254 3300042654 Bacteria 86814
44 Ga0466701_046632 3300042598 Bacteria 3708
45 Ga0104049_1025041 3300007103 Bacteria 3810
46 Ga0102737_1000651 3300007142 Bacteria 11073
47 Ga0103264_1000206 3300007188 Bacteria 33853
48 Ga0103264_1000240 3300007188 Bacteria 40495
49 Ga0103264_1000470 3300007188 Bacteria 20696
50 Ga0123357_10000234 3300009784 Bacteria 52576
51 Ga0466697_232817 3300042611 Bacteria 1033
52 Ga0160456_100132 3300012820 Bacteria 70951
53 Ga0160460_101552 3300012845 Bacteria 7305
54 Ga0415639_283762 3300038395 Bacteria 1545
55 Ga0466704_617252 3300042643 Bacteria 3961
56 Ga0466701_036096 3300042598 Bacteria 59976
57 Ga0466701_102522 3300042598 Bacteria 2295
58 Ga0466717_253861 3300042604 Bacteria 1365
59 CVPL010W_10006354 3300002931 Bacteria 21839
60 CVPL005L_10007640 3300002938 Unclassified 10078
61 Ga0102736_1002504 3300007052 Bacteria 5399
62 Ga0103266_1000735 3300007067 Bacteria 6106
63 Ga0104041_1117390 3300007106 Bacteria 1202
64 Ga0102737_1000367 3300007142 Bacteria 15226
65 Ga0105005_1032231 3300007505 Unclassified 12226
66 Ga0466715_421122 3300042616 Bacteria 1380
67 Ga0466728_108546 3300042620 Bacteria 4247
68 Ga0160458_100011 3300012832 Bacteria 403207
69 Ga0466690_129001 3300042590 Bacteria 52374
70 Ga0466724_35850 3300042649 Bacteria 120573
71 Ga0466701_025399 3300042598 Unclassified 1117
72 Ga0466722_076110 3300042609 Bacteria 2178
73 Ga0466697_025338 3300042611 Bacteria 3518
74 Ga0074188_1155962 3300005318 Unclassified 1875
75 Ga0104041_1003207 3300007106 Bacteria 10957
76 Ga0160436_1002908 3300012861 Unclassified 4271
77 Ga0466693_427178 3300042592 Unclassified 1092
78 Ga0466691_170386 3300042593 Bacteria 1399
79 Ga0123355_10184914 3300009826 Bacteria 3084
80 Ga0123354_10000255 3300010882 Bacteria 47810
81 Ga0466704_520082 3300042643 Bacteria 4944
82 Ga0466701_101121 3300042598 Bacteria 13584
83 JGI24696J40584_12854254 3300002834 Bacteria 991
84 Ga0104049_1000283 3300007103 Bacteria 2790
85 Ga0102740_1015366 3300007140 Bacteria 1177
86 Ga0103264_1000386 3300007188 Bacteria 23118
87 Ga0466697_212227 3300042611 Bacteria 1388
88 Ga0160458_101957 3300012832 Bacteria 3057
89 Ga0160460_105194 3300012845 Unclassified 1894
90 Ga0160448_100185 3300012854 Bacteria 26347
91 Ga0160436_1002808 3300012861 Unclassified 4343
92 Ga0466657_225958 3300042582 Bacteria 10813
93 Ga0466657_269970 3300042582 Bacteria 5068
94 Ga0123355_10056606 3300009826 Bacteria 6344
95 Ga0123356_10432232 3300010049 Bacteria 1461
96 Ga0466725_294995 3300042654 Bacteria 11384
97 Ga0466701_097340 3300042598 Bacteria 56688
98 Ga0466716_086703 3300042605 Bacteria 9202
99 Ga0466719_066365 3300042606 Bacteria 15323
100 IMNBL1DRAFT_c0001579 3300000062 Bacteria 16943
101 CVPL010W_10015599 3300002931 Bacteria 7718
102 CVPL005L_10001011 3300002938 Bacteria 31524
103 Ga0102734_1002219 3300007129 Bacteria 4617
104 Ga0102738_1002141 3300007141 Bacteria 2971
105 Ga0103264_1000006 3300007188 Bacteria 148290
106 Ga0105005_1136525 3300007505 Unclassified 6198
107 Ga0466705_318380 3300042612 Bacteria 2441
108 Ga0466710_088921 3300042613 Bacteria 9562
109 Ga0466710_210705 3300042613 Bacteria 3391
110 Ga0466710_416659 3300042613 Bacteria 3955
111 Ga0466715_208315 3300042616 Bacteria 5634
112 Ga0160468_100063 3300012819 Bacteria 148097
113 Ga0160446_101939 3300012835 Bacteria 3902
114 Ga0160434_100032 3300012850 Bacteria 120271
115 Ga0466696_022758 3300042596 Bacteria 3324
116 Ga0123357_10076357 3300009784 Unclassified 4424
117 Ga0466730_013812 3300042625 Bacteria 185537
118 Ga0466724_63133 3300042649 Bacteria 2810
119 SPBB_contig01483 2044078006 Bacteria 166304
120 CVPL005L_10002651 3300002938 Bacteria 20331
121 Ga0074303_1075276 3300005306 Unclassified 1505
122 Ga0103263_103186 3300007042 Unclassified 1973
123 Ga0104047_1121911 3300007088 Unclassified 1128
124 Ga0102734_1008391 3300007129 Bacteria 5380

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007103 Ga0104049_1025041 Ga0104049_10250411 172
2 3300007129 Ga0102734_1002219 Ga0102734_10022193 181
3 3300007505 Ga0105005_1136525 Ga0105005_11365258 182
4 3300042649 Ga0466724_63133 Ga0466724_63133_1995_2630 202
5 3300012839 Ga0160472_103698 Ga0160472_1036982 203
6 3300012854 Ga0160448_100185 Ga0160448_10018524 203
7 3300012832 Ga0160458_100011 Ga0160458_100011115 204
8 3300012849 Ga0160447_100740 Ga0160447_1007403 205
9 3300012850 Ga0160434_100032 Ga0160434_10003293 205
10 3300012857 Ga0160435_1000212 Ga0160435_100021224 205
11 3300012861 Ga0160436_1002808 Ga0160436_10028082 205
12 3300012861 Ga0160436_1002908 Ga0160436_10029084 205
13 3300012820 Ga0160456_100132 Ga0160456_10013238 206
14 3300012845 Ga0160460_100364 Ga0160460_10036412 206
15 3300042613 Ga0466710_067864 Ga0466710_067864_1923_2546 207
16 3300007106 Ga0104041_1117390 Ga0104041_11173901 208
17 3300042590 Ga0466690_129001 Ga0466690_129001_20478_21104 208
18 3300042598 Ga0466701_101121 Ga0466701_101121_10149_10775 208
19 3300042606 Ga0466719_066365 Ga0466719_066365_9889_10515 208
20 3300042649 Ga0466724_37273 Ga0466724_37273_188_814 208
21 iso_pr_bacteria 2603880170 2606027987 208
22 iso_pr_bacteria 2687453742 2689988787 208
23 iso_pr_bacteria 2864808494 2864811030 208
24 iso_pr_bacteria 2864812326 2864815007 208
25 iso_pr_bacteria 2864859030 2864860468 208
26 iso_pr_bacteria 2864914039 2864915511 208
27 iso_pr_bacteria 2864988360 2864993008 208
28 3300002931 CVPL010W_10006354 CVPL010W_1000635431 209
29 3300002931 CVPL010W_10015599 CVPL010W_100155999 209
30 3300002938 CVPL005L_10001011 CVPL005L_1000101111 209
31 3300002938 CVPL005L_10002651 CVPL005L_1000265117 209
32 3300002938 CVPL005L_10007640 CVPL005L_1000764010 209
33 3300005306 Ga0074303_1075276 Ga0074303_10752762 209
34 3300005318 Ga0074188_1155962 Ga0074188_11559621 209
35 3300007083 Ga0103261_1000985 Ga0103261_10009856 209
36 3300007088 Ga0104047_1121911 Ga0104047_11219112 209
37 3300007106 Ga0104041_1003207 Ga0104041_10032078 209
38 3300007140 Ga0102740_1015366 Ga0102740_10153662 209
39 3300007142 Ga0102737_1000367 Ga0102737_100036711 209
40 3300007142 Ga0102737_1000651 Ga0102737_10006516 209
41 3300007188 Ga0103264_1000006 Ga0103264_1000006107 209
42 3300007188 Ga0103264_1000206 Ga0103264_100020624 209
43 3300007188 Ga0103264_1000470 Ga0103264_10004701 209
44 3300007188 Ga0103264_1000510 Ga0103264_100051025 209
45 3300007505 Ga0105005_1032231 Ga0105005_103223113 209
46 3300009826 Ga0123355_10056606 Ga0123355_100566061 209
47 3300009826 Ga0123355_10184914 Ga0123355_101849143 209
48 3300042582 Ga0466657_269970 Ga0466657_269970_1619_2248 209
49 3300042590 Ga0466690_121661 Ga0466690_121661_357_986 209
50 3300042591 Ga0466692_101940 Ga0466692_101940_28490_29119 209
51 3300042592 Ga0466693_427178 Ga0466693_427178_128_757 209
52 3300042609 Ga0466722_076110 Ga0466722_076110_599_1228 209
53 3300042612 Ga0466705_318380 Ga0466705_318380_30_659 209
54 3300042615 Ga0466711_115466 Ga0466711_115466_6512_7141 209
55 3300042616 Ga0466715_208315 Ga0466715_208315_3729_4358 209
56 3300042616 Ga0466715_421122 Ga0466715_421122_402_1031 209
57 3300042618 Ga0466723_039361 Ga0466723_039361_1079_1708 209
58 3300042643 Ga0466704_288860 Ga0466704_288860_486_1115 209
59 3300042643 Ga0466704_520082 Ga0466704_520082_1875_2504 209
60 3300042643 Ga0466704_617252 Ga0466704_617252_1663_2292 209
61 iso_pr_bacteria 2687453753 2690037408 209
62 iso_pr_bacteria 2820084079 2820084526 209
63 iso_pr_bacteria 2820086750 2820088743 209
64 iso_pr_bacteria 2820123897 2820126790 209
65 iso_pr_bacteria 2891720358 2891721251 209
66 iso_pr_bacteria 8103002986 8103006592 209
67 iso_pr_bacteria 8103008710 8103014245 209
68 3300002834 JGI24696J40584_12854254 JGI24696J40584_128542541 210
69 3300002934 CVPL005W_1000027 CVPL005W_100002751 210
70 3300007067 Ga0103266_1000735 Ga0103266_10007354 210
71 3300007188 Ga0103264_1000240 Ga0103264_100024027 210
72 3300009784 Ga0123357_10000234 Ga0123357_1000023431 210
73 3300010882 Ga0123354_10000255 Ga0123354_1000025516 210
74 3300038395 Ga0415639_283762 Ga0415639_283762_400_1032 210
75 3300042655 Ga0466727_143538 Ga0466727_143538_1818_2450 210
76 iso_pr_bacteria 2603880165 2606014464 210
77 iso_pr_bacteria 2820077244 2820078121 210
78 3300007129 Ga0102734_1008391 Ga0102734_10083914 211
79 3300010882 Ga0123354_10000024 Ga0123354_100000249 211
80 3300042592 Ga0466693_181172 Ga0466693_181172_1921_2556 211
81 3300042596 Ga0466696_036930 Ga0466696_036930_769_1404 211
82 3300042596 Ga0466696_134534 Ga0466696_134534_1018_1653 211
83 3300042598 Ga0466701_025399 Ga0466701_025399_419_1054 211
84 3300042598 Ga0466701_036096 Ga0466701_036096_23240_23875 211
85 3300042598 Ga0466701_046632 Ga0466701_046632_2307_2942 211
86 3300042598 Ga0466701_102522 Ga0466701_102522_426_1061 211
87 3300042611 Ga0466697_025338 Ga0466697_025338_2172_2807 211
88 3300042612 Ga0466705_179154 Ga0466705_179154_134_769 211
89 3300042643 Ga0466704_014985 Ga0466704_014985_1745_2380 211
90 3300042654 Ga0466725_285254 Ga0466725_285254_26820_27455 211
91 3300042659 Ga0466733_055935 Ga0466733_055935_510_1145 211
92 iso_pr_bacteria 2820071837 2820071964 211
93 iso_pr_bacteria 2864826666 2864831054 211
94 iso_pr_bacteria 2864937364 2864941730 211
95 iso_pr_bacteria 8100449422 8100454582 211
96 iso_pr_bacteria 8100455565 8100461147 211
97 iso_pr_bacteria 8100461708 8100462389 211
98 2032320009 DPO_contig00424 DPOB_500080 212
99 3300000062 IMNBL1DRAFT_c0001579 IMNBL1DRAFT_00015799 212
100 3300007042 Ga0103263_103186 Ga0103263_1031863 212
101 3300007052 Ga0102736_1002504 Ga0102736_10025042 212
102 3300007083 Ga0103261_1003499 Ga0103261_10034991 212
103 3300007139 Ga0103260_1000990 Ga0103260_10009904 212
104 3300007140 Ga0102740_1002268 Ga0102740_10022684 212
105 3300007141 Ga0102738_1002141 Ga0102738_10021413 212
106 3300007142 Ga0102737_1002340 Ga0102737_10023404 212
107 3300007188 Ga0103264_1000386 Ga0103264_100038613 212
108 3300007188 Ga0103264_1025441 Ga0103264_10254412 212
109 3300007188 Ga0103264_1040311 Ga0103264_10403112 212
110 3300042582 Ga0466657_225958 Ga0466657_225958_5326_5964 212
111 3300042611 Ga0466697_031615 Ga0466697_031615_1726_2364 212
112 3300042613 Ga0466710_039713 Ga0466710_039713_872_1510 212
113 3300042613 Ga0466710_416659 Ga0466710_416659_3192_3830 212
114 3300042654 Ga0466725_294995 Ga0466725_294995_3302_3940 212
115 iso_pr_bacteria 2820157249 2820157375 212
116 iso_pr_bacteria 2820951912 2820953982 212
117 3300009784 Ga0123357_10076357 Ga0123357_100763572 213
118 3300042593 Ga0466691_170386 Ga0466691_170386_442_1083 213
119 3300042604 Ga0466717_253861 Ga0466717_253861_650_1291 213
120 3300042612 Ga0466705_350039 Ga0466705_350039_411_1052 213
121 3300042619 Ga0466726_021117 Ga0466726_021117_2140_2781 213
122 iso_pr_bacteria 2874434233 2874438847 213
123 iso_pr_bacteria 2874504452 2874505624 213
124 iso_pr_bacteria 2922113941 2922115621 213
125 iso_pr_bacteria 2937735258 2937739963 213
126 iso_pr_bacteria 2937751072 2937755078 213
127 iso_pr_bacteria 2961206375 2961209779 213
128 iso_pr_bacteria 2961232173 2961234656 213
129 iso_pr_bacteria 2961247850 2961251259 213
130 iso_pr_bacteria 2965197371 2965197711 213
131 iso_pr_bacteria 2970791725 2970796035 213
132 iso_pr_bacteria 2978161719 2978166147 213
133 iso_pr_bacteria 2996406003 2996408222 213
134 iso_pr_bacteria 2996467878 2996471936 213
135 iso_pr_bacteria 8004285568 8004287443 213
136 iso_pr_bacteria 8004307473 8004309730 213
137 iso_pr_bacteria 8004571736 8004573342 213
138 iso_pr_bacteria 8004582426 8004585500 213
139 3300010882 Ga0123354_10099949 Ga0123354_100999495 214
140 3300012819 Ga0160468_100063 Ga0160468_10006314 214
141 3300042594 Ga0466694_377649 Ga0466694_377649_5110_5754 214
142 3300042613 Ga0466710_088921 Ga0466710_088921_124_768 214
143 3300007103 Ga0104049_1000283 Ga0104049_10002832 215
144 3300042598 Ga0466701_005129 Ga0466701_005129_1927_2574 215
145 3300042598 Ga0466701_025431 Ga0466701_025431_434_1081 215
146 3300042611 Ga0466697_212227 Ga0466697_212227_521_1168 215
147 3300042623 Ga0466734_010742 Ga0466734_010742_1464_2111 215
148 3300042625 Ga0466730_001347 Ga0466730_001347_24688_25335 215
149 3300042625 Ga0466730_013812 Ga0466730_013812_167527_168174 215
150 3300042649 Ga0466724_35850 Ga0466724_35850_17159_17806 215
151 iso_pr_bacteria 2603880172 2606033090 215
152 3300012832 Ga0160458_101957 Ga0160458_1019573 216
153 3300012835 Ga0160446_101748 Ga0160446_1017482 216
154 3300012835 Ga0160446_101939 Ga0160446_1019393 216
155 3300012845 Ga0160460_101552 Ga0160460_1015524 216
156 3300012845 Ga0160460_105194 Ga0160460_1051942 216
157 3300042611 Ga0466697_232817 Ga0466697_232817_114_764 216
158 3300042620 Ga0466728_108546 Ga0466728_108546_309_962 217
159 iso_pr_bacteria 2855798354 2855799481 217
160 3300042613 Ga0466710_210705 Ga0466710_210705_2444_3100 218
161 3300042623 Ga0466734_162035 Ga0466734_162035_3929_4585 218
162 iso_pr_bacteria 8024031916 8024032334 218
163 3300010049 Ga0123356_10432232 Ga0123356_104322322 220
164 3300042596 Ga0466696_022758 Ga0466696_022758_2014_2676 220
165 2044078006 SPBB_contig01483 SPBB_947830 221
166 3300042598 Ga0466701_097340 Ga0466701_097340_18904_19569 221
167 3300042604 Ga0466717_296892 Ga0466717_296892_4310_4981 223
168 3300042605 Ga0466716_086703 Ga0466716_086703_2259_2930 223

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01161 PBP Phosphatidylethanolamine-binding protein 43 215 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.92 0.95 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.