Protein Family IF06286

Metagenome Metatranscriptome Isolate
193 Members
40 Samples
184 Scaffolds
101.75 Avg Length

🧬 Representative Sequence

ID
3300042604|Ga0466717_288406|Ga0466717_288406_222_581
Length
119 aa
Sequence
MIYRTCYGAVFWRKIESIMEPRVKDKSSSKTNQKHKEPDEFRVILLNDHFTTMEFVVEVLMVIFHKSIVDATRIMLDVHKKGKGVVGTYTWDIAATKSEQVHSAAKANEFPLRCIVEPA

πŸ“Š Sample Types

Isolate 4.7%
Metagenome 94.8%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 59.5%
Unclassified 27.0%
Rhinotermitidae 8.1%
Kalotermitidae 5.4%

🌳 Taxonomy

Archaea 1
Bacteria 172
Eukaryota 0
Viruses 1
Unclassified 19

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
2 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
3 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
4 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
5 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
6 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
7 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
8 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
9 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
18 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
19 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
23 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
28 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
32 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
33 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
39 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
40 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10001536 3300010049 Bacteria 25429
2 AustNasuHG_c1000303 3300000089 Bacteria 17120
3 JGI24698J34947_10005108 3300002449 Bacteria 7193
4 JGI24698J34947_10020125 3300002449 Bacteria 3598
5 JGI24698J34947_10028068 3300002449 Bacteria 2982
6 JGI24698J34947_10070659 3300002449 Bacteria 1679
7 JGI24695J34938_10015048 3300002450 Bacteria 3984
8 JGI24695J34938_10044859 3300002450 Bacteria 1964
9 Ga0072941_1041398 3300005201 Bacteria 6203
10 Ga0466711_084337 3300042615 Bacteria 1846
11 Ga0466717_223110 3300042604 Unclassified 1254
12 Ga0466717_288406 3300042604 Bacteria 1606
13 Ga0415639_069747 3300038395 Bacteria 2198
14 Ga0466694_244941 3300042594 Bacteria 2199
15 Ga0466699_173294 3300042597 Bacteria 2607
16 Ga0466699_281419 3300042597 Bacteria 2652
17 Ga0466699_409694 3300042597 Unclassified 2161
18 Ga0123356_11565306 3300010049 Bacteria 815
19 AustNasuHG_c1054921 3300000089 Bacteria 815
20 JGI24698J34947_10055101 3300002449 Bacteria 1982
21 JGI24698J34947_10073111 3300002449 Bacteria 1638
22 JGI24698J34947_10166045 3300002449 Bacteria 899
23 JGI24698J34947_10194829 3300002449 Unclassified 799
24 JGI24695J34938_10001987 3300002450 Bacteria 16303
25 JGI24695J34938_10005193 3300002450 Bacteria 8224
26 Ga0072941_1006089 3300005201 Bacteria 13182
27 Ga0072941_1007170 3300005201 Bacteria 10080
28 Ga0072941_1137423 3300005201 Unclassified 1217
29 Ga0466712_108524 3300042614 Unclassified 6069
30 Ga0466712_183454 3300042614 Bacteria 22573
31 Ga0466718_028602 3300042617 Bacteria 1641
32 Ga0466718_165905 3300042617 Bacteria 1739
33 Ga0466700_321160 3300042600 Bacteria 1679
34 Ga0466720_024663 3300042607 Bacteria 19387
35 Ga0466720_084664 3300042607 Unclassified 2135
36 Ga0466698_492573 3300042610 Bacteria 1482
37 Ga0466693_413543 3300042592 Bacteria 3993
38 Ga0466699_028650 3300042597 Bacteria 1859
39 Ga0466699_171355 3300042597 Bacteria 6109
40 Ga0123356_10027142 3300010049 Bacteria 5369
41 AustNasuHG_c1007479 3300000089 Bacteria 3888
42 FAAS_10341186 3300001880 Unclassified 561
43 JGI24698J34947_10013262 3300002449 Bacteria 4502
44 JGI24698J34947_10013866 3300002449 Bacteria 4394
45 JGI24698J34947_10093753 3300002449 Bacteria 1370
46 Ga0072941_1069984 3300005201 Bacteria 1116
47 Ga0072941_1100072 3300005201 Bacteria 1166
48 Ga0466712_126209 3300042614 Bacteria 14608
49 Ga0466731_216415 3300042622 Bacteria 5933
50 Ga0466702_200494 3300042635 Bacteria 4120
51 Ga0466702_222715 3300042635 Bacteria 24363
52 Ga0466702_259036 3300042635 Bacteria 1145
53 Ga0264413_116836 3300024493 Bacteria 6652
54 Ga0466692_038570 3300042591 Unclassified 2476
55 Ga0466694_081905 3300042594 Bacteria 3374
56 Ga0466699_004758 3300042597 Bacteria 2373
57 Ga0466699_103281 3300042597 Bacteria 6849
58 Ga0466699_377072 3300042597 Bacteria 1244
59 Ga0123356_10004633 3300010049 Bacteria 14166
60 Ga0123356_10006495 3300010049 Bacteria 11784
61 Ga0123356_14068268 3300010049 Bacteria 503
62 JGI24698J34947_10001029 3300002449 Bacteria 14367
63 JGI24698J34947_10001055 3300002449 Bacteria 14211
64 JGI24698J34947_10016954 3300002449 Bacteria 3952
65 JGI24698J34947_10019508 3300002449 Bacteria 3657
66 JGI24698J34947_10053344 3300002449 Bacteria 2024
67 JGI24695J34938_10090235 3300002450 Bacteria 1258
68 Ga0072941_1015670 3300005201 Bacteria 5523
69 Ga0072941_1037178 3300005201 Unclassified 4670
70 Ga0072941_1225425 3300005201 Bacteria 1630
71 Ga0466712_227933 3300042614 Bacteria 5601
72 Ga0466712_237286 3300042614 Unclassified 2175
73 Ga0466712_245241 3300042614 Bacteria 6362
74 Ga0466720_088859 3300042607 Unclassified 6704
75 Ga0415639_011107 3300038395 Bacteria 10902
76 Ga0466692_060239 3300042591 Bacteria 14331
77 Ga0466694_184604 3300042594 Bacteria 1422
78 Ga0466699_047545 3300042597 Bacteria 19364
79 Ga0466699_097054 3300042597 Bacteria 1485
80 Ga0466699_103731 3300042597 Bacteria 1150
81 Ga0123356_10000599 3300010049 Bacteria 39960
82 Ga0123356_10031942 3300010049 Bacteria 4927
83 Ga0123353_10193279 3300010167 Bacteria 3210
84 Ga0123353_10606463 3300010167 Bacteria 1563
85 AustNasuHG_c1073238 3300000089 Bacteria 608
86 JGI24698J34947_10025977 3300002449 Unclassified 3114
87 JGI24698J34947_10097239 3300002449 Bacteria 1334
88 JGI24698J34947_10132137 3300002449 Bacteria 1065
89 JGI24698J34947_10174645 3300002449 Bacteria 865
90 JGI24698J34947_10326890 3300002449 Bacteria 544
91 Ga0072941_1000873 3300005201 Bacteria 15327
92 Ga0072941_1055798 3300005201 Bacteria 2271
93 Ga0072941_1069983 3300005201 Bacteria 1889
94 Ga0466712_245745 3300042614 Bacteria 1844
95 Ga0466715_350176 3300042616 Bacteria 41481
96 Ga0466718_039231 3300042617 Bacteria 7246
97 Ga0466717_110719 3300042604 Bacteria 3087
98 Ga0466722_062823 3300042609 Bacteria 9032
99 Ga0466722_144659 3300042609 Bacteria 1452
100 Ga0466694_166355 3300042594 Bacteria 109748
101 Ga0466699_172518 3300042597 Bacteria 1469
102 Ga0466699_325984 3300042597 Unclassified 1269
103 Ga0466732_257541 3300042656 Bacteria 1529
104 AustNasuHG_c1000124 3300000089 Bacteria 23612
105 JGI24698J34947_10014774 3300002449 Bacteria 4252
106 JGI24698J34947_10036027 3300002449 Bacteria 2578
107 JGI24698J34947_10082218 3300002449 Unclassified 1506
108 JGI24695J34938_10013860 3300002450 Bacteria 4212
109 JGI24695J34938_10018958 3300002450 Bacteria 3422
110 JGI24695J34938_10022780 3300002450 Bacteria 3033
111 Ga0072941_1012828 3300005201 Bacteria 2833
112 Ga0072941_1014027 3300005201 Bacteria 15119
113 Ga0072941_1100525 3300005201 Bacteria 3212
114 Ga0072941_1112230 3300005201 Bacteria 2049
115 Ga0072941_1281772 3300005201 Bacteria 909
116 Ga0466712_037176 3300042614 Bacteria 5377
117 Ga0466712_154314 3300042614 Bacteria 3186
118 Ga0466712_206519 3300042614 Bacteria 14431
119 Ga0466707_327128 3300042601 Bacteria 1346
120 Ga0466720_112903 3300042607 Bacteria 4495
121 Ga0466722_026891 3300042609 Bacteria 6790
122 Ga0466722_248540 3300042609 Bacteria 7927
123 Ga0264413_123778 3300024493 Bacteria 1430
124 Ga0415639_117708 3300038395 Bacteria 5489
125 Ga0466699_141814 3300042597 Bacteria 6825
126 Ga0466732_433561 3300042656 Bacteria 2307
127 Ga0123356_10030847 3300010049 Bacteria 5015
128 Ga0123356_10283708 3300010049 Bacteria 1753
129 Ga0123356_10922816 3300010049 Bacteria 1044
130 Ga0123353_10012678 3300010167 Bacteria 12012
131 Ga0123353_10062562 3300010167 Bacteria 5969
132 Ga0123353_10770374 3300010167 Bacteria 1335
133 Ga0123353_12828518 3300010167 Bacteria 568
134 Ga0123354_11072496 3300010882 Bacteria 513
135 AustNasuHG_c1054698 3300000089 Bacteria 818
136 AustNasuHG_c1061301 3300000089 Bacteria 726
137 JGI24698J34947_10002757 3300002449 Bacteria 9506
138 JGI24698J34947_10015689 3300002449 Bacteria 4120
139 JGI24698J34947_10022094 3300002449 Bacteria 3414
140 JGI24698J34947_10055258 3300002449 Unclassified 1979
141 JGI24698J34947_10272997 3300002449 Unclassified 621
142 JGI24695J34938_10000468 3300002450 Bacteria 39224
143 Ga0072940_1012917 3300005200 Archaea 1314
144 Ga0072941_1018111 3300005201 Bacteria 3896
145 Ga0072941_1042293 3300005201 Bacteria 10302
146 Ga0072941_1100084 3300005201 Bacteria 1098
147 Ga0466712_019223 3300042614 Bacteria 2862
148 Ga0466712_054915 3300042614 Bacteria 81067
149 Ga0466712_213999 3300042614 Unclassified 1716
150 Ga0466702_433258 3300042635 Bacteria 2198
151 Ga0466717_053772 3300042604 Bacteria 2109
152 Ga0466720_077696 3300042607 Bacteria 4589
153 Ga0466720_086931 3300042607 Bacteria 9751
154 Ga0466722_194028 3300042609 Bacteria 4188
155 Ga0255786_1010150 3300022815 Bacteria 843
156 Ga0456237_0010812 3300041968 Bacteria 1341
157 Ga0466694_373238 3300042594 Viruses 1520
158 Ga0466699_014540 3300042597 Bacteria 1133
159 Ga0466699_145062 3300042597 Bacteria 2287
160 Ga0466699_193339 3300042597 Unclassified 4022
161 Ga0123356_10007587 3300010049 Unclassified 10815
162 Ga0123356_10170677 3300010049 Bacteria 2185
163 Ga0123356_11104699 3300010049 Bacteria 961
164 JGI24698J34947_10031851 3300002449 Bacteria 2772
165 JGI24695J34938_10009253 3300002450 Bacteria 5494
166 JGI24695J34938_10061920 3300002450 Bacteria 1591
167 JGI24695J34938_10071453 3300002450 Bacteria 1450
168 Ga0072941_1042834 3300005201 Bacteria 3074
169 Ga0072941_1044665 3300005201 Bacteria 8543
170 Ga0466712_131404 3300042614 Bacteria 1070
171 Ga0466712_298591 3300042614 Bacteria 10678
172 Ga0466718_038918 3300042617 Bacteria 4519
173 Ga0466702_148146 3300042635 Bacteria 14926
174 Ga0466717_040978 3300042604 Bacteria 2178
175 Ga0264413_109836 3300024493 Bacteria 6419
176 Ga0415639_016832 3300038395 Bacteria 17793
177 Ga0466694_020366 3300042594 Bacteria 2708
178 Ga0466694_053284 3300042594 Bacteria 9886
179 Ga0466694_120227 3300042594 Bacteria 1909
180 Ga0466695_230426 3300042595 Bacteria 1019
181 Ga0466699_084454 3300042597 Bacteria 16061
182 Ga0466699_133626 3300042597 Bacteria 1623
183 Ga0466699_301809 3300042597 Bacteria 1420
184 Ga0466699_403755 3300042597 Bacteria 1465

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042594 Ga0466694_020366 Ga0466694_020366_202_504 100
2 3300042594 Ga0466694_053284 Ga0466694_053284_7134_7436 100
3 3300042594 Ga0466694_081905 Ga0466694_081905_776_1078 100
4 3300042594 Ga0466694_120227 Ga0466694_120227_877_1179 100
5 3300042594 Ga0466694_184604 Ga0466694_184604_984_1286 100
6 3300042609 Ga0466722_144659 Ga0466722_144659_443_745 100
7 3300042609 Ga0466722_194028 Ga0466722_194028_1655_1957 100
8 3300010049 Ga0123356_10283708 Ga0123356_102837081 101
9 3300010167 Ga0123353_10770374 Ga0123353_107703742 101
10 3300022815 Ga0255786_1010150 Ga0255786_10101502 101
11 3300024493 Ga0264413_109836 Ga0264413_1098365 101
12 3300024493 Ga0264413_116836 Ga0264413_1168362 101
13 3300024493 Ga0264413_123778 Ga0264413_1237782 101
14 3300038395 Ga0415639_011107 Ga0415639_011107_2184_2489 101
15 3300038395 Ga0415639_016832 Ga0415639_016832_11730_12035 101
16 3300038395 Ga0415639_069747 Ga0415639_069747_1586_1891 101
17 3300038395 Ga0415639_117708 Ga0415639_117708_1495_1800 101
18 3300041968 Ga0456237_0010812 Ga0456237_0010812_245_550 101
19 3300042591 Ga0466692_038570 Ga0466692_038570_1362_1667 101
20 3300042591 Ga0466692_060239 Ga0466692_060239_4487_4792 101
21 3300042592 Ga0466693_413543 Ga0466693_413543_1354_1659 101
22 3300042594 Ga0466694_166355 Ga0466694_166355_92410_92715 101
23 3300042594 Ga0466694_244941 Ga0466694_244941_579_884 101
24 3300042594 Ga0466694_373238 Ga0466694_373238_894_1199 101
25 3300042595 Ga0466695_230426 Ga0466695_230426_19_324 101
26 3300042597 Ga0466699_004758 Ga0466699_004758_735_1040 101
27 3300042597 Ga0466699_014540 Ga0466699_014540_625_930 101
28 3300042597 Ga0466699_028650 Ga0466699_028650_67_372 101
29 3300042597 Ga0466699_047545 Ga0466699_047545_13882_14187 101
30 3300042597 Ga0466699_084454 Ga0466699_084454_1298_1603 101
31 3300042597 Ga0466699_097054 Ga0466699_097054_1105_1410 101
32 3300042597 Ga0466699_103281 Ga0466699_103281_4556_4861 101
33 3300042597 Ga0466699_103731 Ga0466699_103731_404_709 101
34 3300042597 Ga0466699_133626 Ga0466699_133626_244_549 101
35 3300042597 Ga0466699_141814 Ga0466699_141814_5528_5833 101
36 3300042597 Ga0466699_145062 Ga0466699_145062_1706_2011 101
37 3300042597 Ga0466699_171355 Ga0466699_171355_5724_6029 101
38 3300042597 Ga0466699_172518 Ga0466699_172518_771_1076 101
39 3300042597 Ga0466699_173294 Ga0466699_173294_878_1183 101
40 3300042597 Ga0466699_193339 Ga0466699_193339_1884_2189 101
41 3300042597 Ga0466699_281419 Ga0466699_281419_999_1304 101
42 3300042597 Ga0466699_301809 Ga0466699_301809_128_433 101
43 3300042597 Ga0466699_325984 Ga0466699_325984_842_1147 101
44 3300042597 Ga0466699_377072 Ga0466699_377072_271_576 101
45 3300042597 Ga0466699_403755 Ga0466699_403755_389_694 101
46 3300042597 Ga0466699_409694 Ga0466699_409694_234_539 101
47 3300042600 Ga0466700_321160 Ga0466700_321160_1219_1524 101
48 3300042604 Ga0466717_040978 Ga0466717_040978_158_463 101
49 3300042604 Ga0466717_053772 Ga0466717_053772_1122_1427 101
50 3300042604 Ga0466717_110719 Ga0466717_110719_910_1215 101
51 3300042604 Ga0466717_223110 Ga0466717_223110_907_1212 101
52 3300042607 Ga0466720_024663 Ga0466720_024663_336_641 101
53 3300042607 Ga0466720_077696 Ga0466720_077696_1276_1581 101
54 3300042607 Ga0466720_084664 Ga0466720_084664_1191_1496 101
55 3300042607 Ga0466720_086931 Ga0466720_086931_1276_1581 101
56 3300042607 Ga0466720_088859 Ga0466720_088859_4025_4330 101
57 3300042607 Ga0466720_112903 Ga0466720_112903_1947_2252 101
58 3300042609 Ga0466722_026891 Ga0466722_026891_592_897 101
59 3300042609 Ga0466722_062823 Ga0466722_062823_4323_4628 101
60 3300042609 Ga0466722_248540 Ga0466722_248540_5027_5332 101
61 3300042610 Ga0466698_492573 Ga0466698_492573_327_632 101
62 3300042614 Ga0466712_019223 Ga0466712_019223_1742_2047 101
63 3300042614 Ga0466712_037176 Ga0466712_037176_39_344 101
64 3300042614 Ga0466712_054915 Ga0466712_054915_24911_25216 101
65 3300042614 Ga0466712_108524 Ga0466712_108524_1472_1777 101
66 3300042614 Ga0466712_126209 Ga0466712_126209_13488_13793 101
67 3300042614 Ga0466712_131404 Ga0466712_131404_663_968 101
68 3300042614 Ga0466712_154314 Ga0466712_154314_2483_2788 101
69 3300042614 Ga0466712_183454 Ga0466712_183454_10428_10733 101
70 3300042614 Ga0466712_206519 Ga0466712_206519_3794_4099 101
71 3300042614 Ga0466712_213999 Ga0466712_213999_425_730 101
72 3300042614 Ga0466712_227933 Ga0466712_227933_557_862 101
73 3300042614 Ga0466712_237286 Ga0466712_237286_872_1177 101
74 3300042614 Ga0466712_245241 Ga0466712_245241_899_1204 101
75 3300042614 Ga0466712_245745 Ga0466712_245745_1487_1792 101
76 3300042614 Ga0466712_298591 Ga0466712_298591_10243_10548 101
77 3300042617 Ga0466718_028602 Ga0466718_028602_1297_1602 101
78 3300042617 Ga0466718_038918 Ga0466718_038918_728_1033 101
79 3300042617 Ga0466718_039231 Ga0466718_039231_6528_6833 101
80 3300042617 Ga0466718_165905 Ga0466718_165905_462_767 101
81 3300042622 Ga0466731_216415 Ga0466731_216415_2026_2331 101
82 3300042635 Ga0466702_148146 Ga0466702_148146_9547_9852 101
83 3300042635 Ga0466702_200494 Ga0466702_200494_1839_2144 101
84 3300042635 Ga0466702_222715 Ga0466702_222715_18922_19227 101
85 3300042635 Ga0466702_259036 Ga0466702_259036_723_1028 101
86 3300042635 Ga0466702_433258 Ga0466702_433258_34_339 101
87 3300042656 Ga0466732_257541 Ga0466732_257541_88_393 101
88 3300042656 Ga0466732_433561 Ga0466732_433561_1169_1474 101
89 iso_pr_bacteria 2781125634 2781273913 101
90 iso_pr_bacteria 2781125638 2781285148 101
91 iso_pr_bacteria 2781125640 2781287089 101
92 iso_pr_bacteria 2781125643 2781294427 101
93 iso_pr_bacteria 2781125657 2781324068 101
94 iso_pr_bacteria 2781125659 2781328012 101
95 iso_pr_bacteria 2781125665 2781341988 101
96 iso_pr_bacteria 2819992462 2819993828 101
97 iso_pr_bacteria 2820020240 2820020925 101
98 3300000089 AustNasuHG_c1000124 AustNasuHG_100012417 102
99 3300000089 AustNasuHG_c1000303 AustNasuHG_10003036 102
100 3300000089 AustNasuHG_c1007479 AustNasuHG_10074792 102
101 3300000089 AustNasuHG_c1054698 AustNasuHG_10546982 102
102 3300000089 AustNasuHG_c1054921 AustNasuHG_10549213 102
103 3300000089 AustNasuHG_c1061301 AustNasuHG_10613011 102
104 3300000089 AustNasuHG_c1073238 AustNasuHG_10732382 102
105 3300001880 FAAS_10341186 FAAS_103411861 102
106 3300002449 JGI24698J34947_10001029 JGI24698J34947_1000102915 102
107 3300002449 JGI24698J34947_10001055 JGI24698J34947_1000105514 102
108 3300002449 JGI24698J34947_10002757 JGI24698J34947_100027579 102
109 3300002449 JGI24698J34947_10005108 JGI24698J34947_100051085 102
110 3300002449 JGI24698J34947_10013262 JGI24698J34947_100132623 102
111 3300002449 JGI24698J34947_10013866 JGI24698J34947_100138662 102
112 3300002449 JGI24698J34947_10014774 JGI24698J34947_100147742 102
113 3300002449 JGI24698J34947_10015689 JGI24698J34947_100156894 102
114 3300002449 JGI24698J34947_10016954 JGI24698J34947_100169542 102
115 3300002449 JGI24698J34947_10019508 JGI24698J34947_100195082 102
116 3300002449 JGI24698J34947_10022094 JGI24698J34947_100220945 102
117 3300002449 JGI24698J34947_10025977 JGI24698J34947_100259772 102
118 3300002449 JGI24698J34947_10028068 JGI24698J34947_100280682 102
119 3300002449 JGI24698J34947_10031851 JGI24698J34947_100318512 102
120 3300002449 JGI24698J34947_10036027 JGI24698J34947_100360272 102
121 3300002449 JGI24698J34947_10053344 JGI24698J34947_100533442 102
122 3300002449 JGI24698J34947_10055101 JGI24698J34947_100551013 102
123 3300002449 JGI24698J34947_10055258 JGI24698J34947_100552585 102
124 3300002449 JGI24698J34947_10070659 JGI24698J34947_100706592 102
125 3300002449 JGI24698J34947_10073111 JGI24698J34947_100731112 102
126 3300002449 JGI24698J34947_10082218 JGI24698J34947_100822182 102
127 3300002449 JGI24698J34947_10093753 JGI24698J34947_100937532 102
128 3300002449 JGI24698J34947_10097239 JGI24698J34947_100972392 102
129 3300002449 JGI24698J34947_10132137 JGI24698J34947_101321372 102
130 3300002449 JGI24698J34947_10166045 JGI24698J34947_101660451 102
131 3300002449 JGI24698J34947_10174645 JGI24698J34947_101746452 102
132 3300002449 JGI24698J34947_10194829 JGI24698J34947_101948292 102
133 3300002449 JGI24698J34947_10272997 JGI24698J34947_102729972 102
134 3300002449 JGI24698J34947_10326890 JGI24698J34947_103268901 102
135 3300002450 JGI24695J34938_10000468 JGI24695J34938_1000046818 102
136 3300002450 JGI24695J34938_10001987 JGI24695J34938_1000198712 102
137 3300002450 JGI24695J34938_10005193 JGI24695J34938_100051934 102
138 3300002450 JGI24695J34938_10009253 JGI24695J34938_100092533 102
139 3300002450 JGI24695J34938_10013860 JGI24695J34938_100138605 102
140 3300002450 JGI24695J34938_10015048 JGI24695J34938_100150485 102
141 3300002450 JGI24695J34938_10018958 JGI24695J34938_100189582 102
142 3300002450 JGI24695J34938_10022780 JGI24695J34938_100227803 102
143 3300002450 JGI24695J34938_10044859 JGI24695J34938_100448592 102
144 3300002450 JGI24695J34938_10061920 JGI24695J34938_100619202 102
145 3300002450 JGI24695J34938_10071453 JGI24695J34938_100714531 102
146 3300002450 JGI24695J34938_10090235 JGI24695J34938_100902352 102
147 3300005200 Ga0072940_1012917 Ga0072940_10129172 102
148 3300005201 Ga0072941_1000873 Ga0072941_10008737 102
149 3300005201 Ga0072941_1007170 Ga0072941_100717014 102
150 3300005201 Ga0072941_1012828 Ga0072941_10128283 102
151 3300005201 Ga0072941_1014027 Ga0072941_101402714 102
152 3300005201 Ga0072941_1015670 Ga0072941_10156706 102
153 3300005201 Ga0072941_1018111 Ga0072941_10181114 102
154 3300005201 Ga0072941_1037178 Ga0072941_10371785 102
155 3300005201 Ga0072941_1042293 Ga0072941_10422936 102
156 3300005201 Ga0072941_1042834 Ga0072941_10428343 102
157 3300005201 Ga0072941_1044665 Ga0072941_10446652 102
158 3300005201 Ga0072941_1069983 Ga0072941_10699832 102
159 3300005201 Ga0072941_1069984 Ga0072941_10699842 102
160 3300005201 Ga0072941_1100072 Ga0072941_11000723 102
161 3300005201 Ga0072941_1100084 Ga0072941_11000842 102
162 3300005201 Ga0072941_1100525 Ga0072941_11005251 102
163 3300005201 Ga0072941_1112230 Ga0072941_11122302 102
164 3300005201 Ga0072941_1137423 Ga0072941_11374233 102
165 3300005201 Ga0072941_1225425 Ga0072941_12254252 102
166 3300005201 Ga0072941_1281772 Ga0072941_12817722 102
167 3300010049 Ga0123356_10000599 Ga0123356_1000059918 102
168 3300010049 Ga0123356_10001536 Ga0123356_1000153614 102
169 3300010049 Ga0123356_10004633 Ga0123356_100046333 102
170 3300010049 Ga0123356_10006495 Ga0123356_100064952 102
171 3300010049 Ga0123356_10007587 Ga0123356_100075879 102
172 3300010049 Ga0123356_10027142 Ga0123356_100271426 102
173 3300010049 Ga0123356_10030847 Ga0123356_100308473 102
174 3300010049 Ga0123356_10031942 Ga0123356_100319424 102
175 3300010049 Ga0123356_10170677 Ga0123356_101706773 102
176 3300010049 Ga0123356_10922816 Ga0123356_109228162 102
177 3300010049 Ga0123356_11104699 Ga0123356_111046992 102
178 3300010049 Ga0123356_11565306 Ga0123356_115653062 102
179 3300010049 Ga0123356_14068268 Ga0123356_140682681 102
180 3300010167 Ga0123353_10012678 Ga0123353_100126785 102
181 3300010167 Ga0123353_10062562 Ga0123353_100625623 102
182 3300010167 Ga0123353_10193279 Ga0123353_101932792 102
183 3300010167 Ga0123353_10606463 Ga0123353_106064632 102
184 3300010167 Ga0123353_12828518 Ga0123353_128285182 102
185 3300010882 Ga0123354_11072496 Ga0123354_110724961 102
186 3300042616 Ga0466715_350176 Ga0466715_350176_13280_13588 102
187 3300005201 Ga0072941_1006089 Ga0072941_10060896 103
188 3300005201 Ga0072941_1041398 Ga0072941_10413982 103
189 3300005201 Ga0072941_1055798 Ga0072941_10557983 103
190 3300042615 Ga0466711_084337 Ga0466711_084337_267_578 103
191 3300002449 JGI24698J34947_10020125 JGI24698J34947_100201253 104
192 3300042604 Ga0466717_288406 Ga0466717_288406_222_581 119
193 3300042601 Ga0466707_327128 Ga0466707_327128_845_1252 135

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02617 ClpS ATP-dependent Clp protease adaptor protein ClpS 36 114 0.99

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02617 GO:0030163 protein catabolic process BP

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.