Protein Family IF06282
Metagenome
Isolate
224
Members
111
Samples
173
Scaffolds
294.86
Avg Length
Representative Sequence
- ID
- 3300042604|Ga0466717_259684|Ga0466717_259684_1083_2141
- Length
- 352 aa
- Sequence
- MTVIKLMGRYRVDIRFDTIMPAPQGRRFYVHTAAGRKPLPGCMRSFRAHSRPKKEEKMAIFKGAGVAIITPFHQDFSVDYEKLAELIEFQVNGSTDAIIICGTTGEASTLSHDEHLAVVRFAVKTVAGRIPVIAGTGSNCTETAVHLSQEAEKAGVDGILVVNPYYNKATQKGLYEHYKLIAEGVKIPLIIYNVPSRTGQNILPQTIASLVHDVPNIVGVKEASGDLAQIAMLMHLTNGEIDLYAGNDDIIIPVLALGGIGVISVTSNLAPRQTHEICQKFFDGDLSGSSKMFLDTIPLVAALFCEVSPTPVKKALNLMGKYNGVLRRPLIEMEAQNVPKLEKAMREYGLLS
Sample Types
Isolate
22.8%
Metagenome
77.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.3%
Termitidae
25.7%
Blattidae
12.8%
Kalotermitidae
11.9%
Drosophilidae
5.5%
Curculionidae
2.8%
Passalidae
2.8%
Rhinotermitidae
2.8%
Termopsidae
2.8%
Tenebrionidae
0.9%
Pentatomidae
0.9%
Hodotermitidae
0.9%
Taxonomy
Archaea
0
Bacteria
218
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 2 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 3 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 4 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 5 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 6 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 7 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 12 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 13 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 14 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 15 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 16 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 17 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 18 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 19 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 20 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 21 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 22 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 23 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 24 | 2820032565 | Unclassified Saccharibacteria Th196P3bin19 | Isolate | Unclassified |
| 25 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 28 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 38 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 39 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 40 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 45 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 46 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 47 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 48 | 2820931684 | Unclassified Actinobacteria Emb289P1bin89 | Isolate | Unclassified |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 50 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 51 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 52 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 53 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 54 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 55 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 56 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 57 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 58 | 2820646798 | Unclassified Firmicutes Cu122P5bin36 | Isolate | Unclassified |
| 59 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 60 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 61 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 62 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 63 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 64 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 65 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 66 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 67 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 68 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 75 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 76 | 3300005306 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 1 gut | Metagenome | Drosophilidae |
| 77 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 78 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 79 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 80 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 81 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 82 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 83 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 84 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 85 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 86 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 87 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 88 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 89 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 90 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 91 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 92 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 93 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 94 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 95 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 96 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 97 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 98 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 99 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 100 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 101 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 102 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 103 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 104 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 105 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 106 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 107 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 108 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 109 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 110 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 111 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_133858 | 3300042659 | Bacteria | 6783 |
| 2 | Ga0562375_2332 | 3300056856 | Bacteria | 21520 |
| 3 | Ga0466701_028686 | 3300042598 | Bacteria | 2997 |
| 4 | Ga0466706_158567 | 3300042599 | Bacteria | 30537 |
| 5 | Ga0466706_173612 | 3300042599 | Bacteria | 5551 |
| 6 | Ga0466706_177658 | 3300042599 | Unclassified | 5718 |
| 7 | Ga0466707_241097 | 3300042601 | Bacteria | 4147 |
| 8 | Ga0466707_340158 | 3300042601 | Bacteria | 3512 |
| 9 | Ga0466713_073679 | 3300042602 | Bacteria | 72784 |
| 10 | Ga0466713_137279 | 3300042602 | Unclassified | 7150 |
| 11 | Ga0466714_098456 | 3300042603 | Bacteria | 1122 |
| 12 | Ga0466716_427612 | 3300042605 | Bacteria | 9499 |
| 13 | Ga0466719_269104 | 3300042606 | Bacteria | 15813 |
| 14 | Ga0123355_10000370 | 3300009826 | Bacteria | 58074 |
| 15 | Ga0123355_10006672 | 3300009826 | Bacteria | 17160 |
| 16 | Ga0123355_10081125 | 3300009826 | Bacteria | 5177 |
| 17 | Ga0123355_10107425 | 3300009826 | Bacteria | 4372 |
| 18 | Ga0123355_10189881 | 3300009826 | Bacteria | 3028 |
| 19 | Ga0123353_10000639 | 3300010167 | Bacteria | 42789 |
| 20 | Ga0123353_10111527 | 3300010167 | Bacteria | 4405 |
| 21 | 2227000114 | 2225789003 | Bacteria | 1347 |
| 22 | 2227358543 | 2225789004 | Bacteria | 130700 |
| 23 | IMNBL1DRAFT_c0001064 | 3300000062 | Bacteria | 21175 |
| 24 | JGI24695J34938_10006036 | 3300002450 | Bacteria | 7387 |
| 25 | JGI24705J35276_12230352 | 3300002504 | Bacteria | 3607 |
| 26 | Ga0104041_1000253 | 3300007106 | Bacteria | 11755 |
| 27 | Ga0466704_468700 | 3300042643 | Bacteria | 2793 |
| 28 | Ga0466733_198528 | 3300042659 | Bacteria | 1043 |
| 29 | Ga0466701_046500 | 3300042598 | Bacteria | 4206 |
| 30 | Ga0466706_122429 | 3300042599 | Bacteria | 70491 |
| 31 | Ga0466713_039178 | 3300042602 | Bacteria | 205362 |
| 32 | Ga0466714_167736 | 3300042603 | Bacteria | 6470 |
| 33 | Ga0466717_259684 | 3300042604 | Bacteria | 3264 |
| 34 | Ga0466722_238835 | 3300042609 | Bacteria | 15611 |
| 35 | Ga0466693_164074 | 3300042592 | Bacteria | 1339 |
| 36 | Ga0123355_10051651 | 3300009826 | Bacteria | 6671 |
| 37 | Ga0123355_10386067 | 3300009826 | Bacteria | 1820 |
| 38 | Ga0123355_10579266 | 3300009826 | Bacteria | 1342 |
| 39 | Ga0123356_10019151 | 3300010049 | Bacteria | 6490 |
| 40 | Ga0123353_10516934 | 3300010167 | Bacteria | 1734 |
| 41 | Ga0123354_10000235 | 3300010882 | Bacteria | 49650 |
| 42 | DPOL_contig00086 | 2035918003 | Bacteria | 93085 |
| 43 | IMNBL1DRAFT_c0000220 | 3300000062 | Bacteria | 49966 |
| 44 | IMNBL1DRAFT_c0000460 | 3300000062 | Bacteria | 34038 |
| 45 | Ga0068305_10002195 | 3300005083 | Unclassified | 25614 |
| 46 | Ga0466724_58988 | 3300042649 | Bacteria | 3529 |
| 47 | Ga0466706_202476 | 3300042599 | Bacteria | 1841 |
| 48 | Ga0466707_176737 | 3300042601 | Bacteria | 29441 |
| 49 | Ga0415639_001305 | 3300038395 | Bacteria | 6829 |
| 50 | Ga0415639_069395 | 3300038395 | Bacteria | 8055 |
| 51 | Ga0415639_285632 | 3300038395 | Bacteria | 1187 |
| 52 | Ga0466690_176469 | 3300042590 | Bacteria | 1688 |
| 53 | Ga0123355_10002050 | 3300009826 | Bacteria | 28456 |
| 54 | Ga0123355_10338348 | 3300009826 | Bacteria | 2008 |
| 55 | Ga0123356_10334413 | 3300010049 | Bacteria | 1633 |
| 56 | Ga0123353_10012808 | 3300010167 | Bacteria | 11959 |
| 57 | Ga0123353_10230697 | 3300010167 | Bacteria | 2886 |
| 58 | Ga0466715_232897 | 3300042616 | Bacteria | 4382 |
| 59 | Ga0466715_483797 | 3300042616 | Bacteria | 58432 |
| 60 | Ga0466726_036168 | 3300042619 | Bacteria | 7698 |
| 61 | Ga0104042_1000074 | 3300007130 | Bacteria | 3897 |
| 62 | Ga0105005_1039310 | 3300007505 | Bacteria | 18208 |
| 63 | Ga0466731_121509 | 3300042622 | Bacteria | 1703 |
| 64 | Ga0466704_322452 | 3300042643 | Bacteria | 3769 |
| 65 | Ga0466706_167016 | 3300042599 | Bacteria | 1528 |
| 66 | Ga0466700_466547 | 3300042600 | Bacteria | 1070 |
| 67 | Ga0466698_169800 | 3300042610 | Bacteria | 3375 |
| 68 | Ga0466697_042420 | 3300042611 | Bacteria | 1383 |
| 69 | Ga0123355_10002027 | 3300009826 | Bacteria | 28645 |
| 70 | Ga0123356_10001381 | 3300010049 | Bacteria | 26901 |
| 71 | Ga0123356_10065942 | 3300010049 | Bacteria | 3389 |
| 72 | Ga0123356_10207810 | 3300010049 | Bacteria | 2003 |
| 73 | Ga0123354_10041469 | 3300010882 | Bacteria | 7114 |
| 74 | Ga0466715_483763 | 3300042616 | Bacteria | 20073 |
| 75 | 2227541878 | 2225789004 | Bacteria | 2977 |
| 76 | JGI24695J34938_10024803 | 3300002450 | Bacteria | 2876 |
| 77 | JGI24703J35330_11689259 | 3300002501 | Bacteria | 1889 |
| 78 | Ga0063521_1000344 | 3300003973 | Bacteria | 26815 |
| 79 | Ga0063521_1000553 | 3300003973 | Bacteria | 16365 |
| 80 | Ga0072941_1224194 | 3300005201 | Bacteria | 5216 |
| 81 | Ga0466702_237244 | 3300042635 | Bacteria | 1264 |
| 82 | Ga0466702_324890 | 3300042635 | Bacteria | 1295 |
| 83 | Ga0466702_443794 | 3300042635 | Bacteria | 10333 |
| 84 | Ga0466703_257786 | 3300042636 | Bacteria | 52276 |
| 85 | Ga0466727_164564 | 3300042655 | Bacteria | 1823 |
| 86 | Ga0466706_046179 | 3300042599 | Bacteria | 2005 |
| 87 | Ga0466706_107466 | 3300042599 | Bacteria | 2521 |
| 88 | Ga0466706_135485 | 3300042599 | Bacteria | 1794 |
| 89 | Ga0466700_331316 | 3300042600 | Bacteria | 9353 |
| 90 | Ga0466713_117950 | 3300042602 | Bacteria | 2605 |
| 91 | Ga0466719_453084 | 3300042606 | Unclassified | 4215 |
| 92 | Ga0123355_10039386 | 3300009826 | Bacteria | 7689 |
| 93 | Ga0123355_10351298 | 3300009826 | Bacteria | 1953 |
| 94 | Ga0123353_10003607 | 3300010167 | Bacteria | 19609 |
| 95 | Ga0123353_10225906 | 3300010167 | Bacteria | 2923 |
| 96 | Ga0123353_10306085 | 3300010167 | Bacteria | 2422 |
| 97 | Ga0466728_016388 | 3300042620 | Bacteria | 40038 |
| 98 | 2227141924 | 2225789004 | Bacteria | 8712 |
| 99 | JGI24702J35022_10004279 | 3300002462 | Bacteria | 8515 |
| 100 | JGI24705J35276_12238662 | 3300002504 | Bacteria | 33887 |
| 101 | Ga0068305_10234975 | 3300005083 | Bacteria | 2525 |
| 102 | Ga0072941_1096920 | 3300005201 | Bacteria | 13635 |
| 103 | Ga0466729_262899 | 3300042621 | Bacteria | 3153 |
| 104 | Ga0466731_350380 | 3300042622 | Bacteria | 1450 |
| 105 | Ga0466703_222245 | 3300042636 | Bacteria | 3118 |
| 106 | Ga0466703_343670 | 3300042636 | Bacteria | 7335 |
| 107 | Ga0466704_103189 | 3300042643 | Bacteria | 58965 |
| 108 | Ga0466709_368918 | 3300042648 | Bacteria | 82197 |
| 109 | Ga0466708_400696 | 3300042652 | Bacteria | 9245 |
| 110 | Ga0466725_203071 | 3300042654 | Bacteria | 3490 |
| 111 | Ga0466705_278053 | 3300042612 | Bacteria | 68368 |
| 112 | Ga0466733_025719 | 3300042659 | Bacteria | 1715 |
| 113 | Ga0466706_053647 | 3300042599 | Bacteria | 2370 |
| 114 | Ga0466706_067808 | 3300042599 | Bacteria | 2155 |
| 115 | Ga0466706_102143 | 3300042599 | Bacteria | 1541 |
| 116 | Ga0466706_201942 | 3300042599 | Bacteria | 17932 |
| 117 | Ga0466719_133332 | 3300042606 | Bacteria | 2078 |
| 118 | Ga0415639_066400 | 3300038395 | Bacteria | 7532 |
| 119 | Ga0123355_10015861 | 3300009826 | Bacteria | 11852 |
| 120 | Ga0123355_10086216 | 3300009826 | Bacteria | 4994 |
| 121 | Ga0123355_10197627 | 3300009826 | Bacteria | 2945 |
| 122 | Ga0123356_10207402 | 3300010049 | Bacteria | 2005 |
| 123 | Ga0123353_10021843 | 3300010167 | Bacteria | 9621 |
| 124 | Ga0466726_471877 | 3300042619 | Bacteria | 27246 |
| 125 | JGI24702J35022_10000376 | 3300002462 | Bacteria | 26483 |
| 126 | Ga0068305_10005230 | 3300005083 | Bacteria | 6754 |
| 127 | Ga0466702_116525 | 3300042635 | Bacteria | 1112 |
| 128 | Ga0466703_324489 | 3300042636 | Bacteria | 3903 |
| 129 | Ga0466733_052837 | 3300042659 | Bacteria | 8602 |
| 130 | Ga0466707_080023 | 3300042601 | Bacteria | 16518 |
| 131 | Ga0466721_275466 | 3300042608 | Bacteria | 134922 |
| 132 | Ga0466722_234024 | 3300042609 | Bacteria | 4730 |
| 133 | Ga0466698_107576 | 3300042610 | Bacteria | 7004 |
| 134 | Ga0415639_167887 | 3300038395 | Bacteria | 1277 |
| 135 | Ga0466692_173925 | 3300042591 | Bacteria | 105430 |
| 136 | Ga0466691_212677 | 3300042593 | Bacteria | 4994 |
| 137 | Ga0466696_375600 | 3300042596 | Bacteria | 8621 |
| 138 | Ga0123357_10215037 | 3300009784 | Bacteria | 2148 |
| 139 | Ga0123355_10013326 | 3300009826 | Bacteria | 12787 |
| 140 | Ga0123355_10016048 | 3300009826 | Bacteria | 11789 |
| 141 | Ga0123356_10001092 | 3300010049 | Bacteria | 30038 |
| 142 | Ga0123356_10922735 | 3300010049 | Bacteria | 1044 |
| 143 | Ga0123353_10176507 | 3300010167 | Bacteria | 3387 |
| 144 | Ga0123353_10228224 | 3300010167 | Bacteria | 2905 |
| 145 | Ga0123353_10658997 | 3300010167 | Bacteria | 1480 |
| 146 | Ga0466715_645092 | 3300042616 | Bacteria | 14742 |
| 147 | FGTW_contig30408 | 2065487013 | Bacteria | 95193 |
| 148 | 2227646814 | 2225789004 | Bacteria | 44642 |
| 149 | AustNasuHG_c1017443 | 3300000089 | Bacteria | 2388 |
| 150 | Ga0466735_105457 | 3300042624 | Bacteria | 3348 |
| 151 | Ga0466702_284954 | 3300042635 | Bacteria | 1938 |
| 152 | Ga0466702_311100 | 3300042635 | Bacteria | 5154 |
| 153 | Ga0466703_144979 | 3300042636 | Bacteria | 4611 |
| 154 | Ga0466703_334483 | 3300042636 | Bacteria | 67687 |
| 155 | Ga0466706_194038 | 3300042599 | Bacteria | 6197 |
| 156 | Ga0466706_207135 | 3300042599 | Bacteria | 19890 |
| 157 | Ga0466716_369381 | 3300042605 | Bacteria | 29324 |
| 158 | Ga0466716_480508 | 3300042605 | Bacteria | 2201 |
| 159 | Ga0466697_042804 | 3300042611 | Bacteria | 1502 |
| 160 | Ga0466693_359963 | 3300042592 | Unclassified | 1597 |
| 161 | Ga0123357_10387441 | 3300009784 | Bacteria | 1289 |
| 162 | Ga0123355_10042405 | 3300009826 | Bacteria | 7407 |
| 163 | Ga0123353_10205495 | 3300010167 | Bacteria | 3094 |
| 164 | Ga0466705_396447 | 3300042612 | Unclassified | 1147 |
| 165 | Ga0466711_257953 | 3300042615 | Bacteria | 3689 |
| 166 | IMNBL1DRAFT_c0000009 | 3300000062 | Bacteria | 243341 |
| 167 | IMNBL1DRAFT_c0000060 | 3300000062 | Bacteria | 101547 |
| 168 | IMNBL1DRAFT_c0000484 | 3300000062 | Bacteria | 33175 |
| 169 | JGI24696J40584_12925915 | 3300002834 | Bacteria | 1406 |
| 170 | Ga0074303_1074379 | 3300005306 | Bacteria | 4245 |
| 171 | Ga0104040_1041310 | 3300007149 | Bacteria | 7742 |
| 172 | Ga0466703_093453 | 3300042636 | Bacteria | 24885 |
| 173 | Ga0466709_374255 | 3300042648 | Bacteria | 116572 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042611 | Ga0466697_042420 | Ga0466697_042420_628_1347 | 239 |
| 2 | 3300010049 | Ga0123356_10922735 | Ga0123356_109227351 | 253 |
| 3 | 3300002450 | JGI24695J34938_10024803 | JGI24695J34938_100248032 | 278 |
| 4 | 3300010167 | Ga0123353_10228224 | Ga0123353_102282242 | 278 |
| 5 | 3300042659 | Ga0466733_133858 | Ga0466733_133858_4818_5657 | 279 |
| 6 | 3300042611 | Ga0466697_042804 | Ga0466697_042804_109_990 | 282 |
| 7 | 3300009826 | Ga0123355_10042405 | Ga0123355_100424052 | 283 |
| 8 | 3300042635 | Ga0466702_311100 | Ga0466702_311100_1657_2508 | 283 |
| 9 | 3300010049 | Ga0123356_10001092 | Ga0123356_100010929 | 284 |
| 10 | 3300002501 | JGI24703J35330_11689259 | JGI24703J35330_116892591 | 286 |
| 11 | 3300042602 | Ga0466713_039178 | Ga0466713_039178_124855_125742 | 286 |
| 12 | 3300007505 | Ga0105005_1039310 | Ga0105005_10393106 | 287 |
| 13 | 3300042590 | Ga0466690_176469 | Ga0466690_176469_754_1617 | 287 |
| 14 | 3300042636 | Ga0466703_324489 | Ga0466703_324489_46_924 | 287 |
| 15 | 3300042643 | Ga0466704_468700 | Ga0466704_468700_560_1423 | 287 |
| 16 | 2035918003 | DPOL_contig00086 | DPOLB_406940 | 288 |
| 17 | 2065487013 | FGTW_contig30408 | FGTW_00298000 | 288 |
| 18 | 3300005306 | Ga0074303_1074379 | Ga0074303_10743793 | 288 |
| 19 | 3300007106 | Ga0104041_1000253 | Ga0104041_10002535 | 288 |
| 20 | 3300009826 | Ga0123355_10086216 | Ga0123355_100862162 | 288 |
| 21 | 3300010167 | Ga0123353_10306085 | Ga0123353_103060852 | 288 |
| 22 | iso_pr_bacteria | 2835335304 | 2835339154 | 288 |
| 23 | iso_pr_bacteria | 2837516909 | 2837517060 | 288 |
| 24 | iso_pr_bacteria | 2846386538 | 2846388474 | 288 |
| 25 | iso_pr_bacteria | 8062647588 | 8062652144 | 288 |
| 26 | 3300003973 | Ga0063521_1000344 | Ga0063521_100034410 | 289 |
| 27 | 3300003973 | Ga0063521_1000553 | Ga0063521_10005537 | 289 |
| 28 | 3300007130 | Ga0104042_1000074 | Ga0104042_10000744 | 289 |
| 29 | 3300007149 | Ga0104040_1041310 | Ga0104040_10413103 | 289 |
| 30 | 3300042605 | Ga0466716_369381 | Ga0466716_369381_14568_15437 | 289 |
| 31 | 3300042616 | Ga0466715_232897 | Ga0466715_232897_13_882 | 289 |
| 32 | 3300042652 | Ga0466708_400696 | Ga0466708_400696_2623_3492 | 289 |
| 33 | 3300042636 | Ga0466703_334483 | Ga0466703_334483_3769_4671 | 290 |
| 34 | 3300009784 | Ga0123357_10387441 | Ga0123357_103874411 | 291 |
| 35 | 3300009826 | Ga0123355_10006672 | Ga0123355_100066726 | 291 |
| 36 | 3300009826 | Ga0123355_10189881 | Ga0123355_101898813 | 291 |
| 37 | 3300010049 | Ga0123356_10001381 | Ga0123356_100013816 | 291 |
| 38 | 3300010049 | Ga0123356_10019151 | Ga0123356_100191513 | 291 |
| 39 | 3300038395 | Ga0415639_285632 | Ga0415639_285632_80_955 | 291 |
| 40 | iso_pr_bacteria | 2820931684 | 2820931907 | 291 |
| 41 | 3300010049 | Ga0123356_10207402 | Ga0123356_102074022 | 292 |
| 42 | 3300010167 | Ga0123353_10658997 | Ga0123353_106589972 | 292 |
| 43 | 3300042598 | Ga0466701_028686 | Ga0466701_028686_556_1434 | 292 |
| 44 | 3300042600 | Ga0466700_331316 | Ga0466700_331316_7628_8506 | 292 |
| 45 | 3300042605 | Ga0466716_427612 | Ga0466716_427612_6991_7869 | 292 |
| 46 | 3300042606 | Ga0466719_133332 | Ga0466719_133332_793_1671 | 292 |
| 47 | 3300042620 | Ga0466728_016388 | Ga0466728_016388_10807_11685 | 292 |
| 48 | 3300042622 | Ga0466731_121509 | Ga0466731_121509_348_1226 | 292 |
| 49 | iso_pr_bacteria | 2590828840 | 2593254443 | 292 |
| 50 | iso_pr_bacteria | 2593339124 | 2595063908 | 292 |
| 51 | iso_pr_bacteria | 2636416028 | 2638994604 | 292 |
| 52 | iso_pr_bacteria | 2820474468 | 2820474614 | 292 |
| 53 | iso_pr_bacteria | 2820596822 | 2820597485 | 292 |
| 54 | iso_pr_bacteria | 2820705605 | 2820707040 | 292 |
| 55 | iso_pr_bacteria | 2989309576 | 2989313803 | 292 |
| 56 | 3300009826 | Ga0123355_10107425 | Ga0123355_101074252 | 293 |
| 57 | 3300010049 | Ga0123356_10334413 | Ga0123356_103344132 | 293 |
| 58 | 3300010167 | Ga0123353_10225906 | Ga0123353_102259063 | 293 |
| 59 | 3300042599 | Ga0466706_067808 | Ga0466706_067808_763_1644 | 293 |
| 60 | 3300042601 | Ga0466707_176737 | Ga0466707_176737_23592_24473 | 293 |
| 61 | 3300042621 | Ga0466729_262899 | Ga0466729_262899_863_1744 | 293 |
| 62 | 3300042636 | Ga0466703_144979 | Ga0466703_144979_2460_3341 | 293 |
| 63 | 3300042659 | Ga0466733_025719 | Ga0466733_025719_36_917 | 293 |
| 64 | 3300042659 | Ga0466733_198528 | Ga0466733_198528_130_1011 | 293 |
| 65 | iso_pr_bacteria | 2820267566 | 2820270697 | 293 |
| 66 | iso_pr_bacteria | 2820495292 | 2820495667 | 293 |
| 67 | 3300009826 | Ga0123355_10002050 | Ga0123355_1000205014 | 294 |
| 68 | 3300009826 | Ga0123355_10051651 | Ga0123355_100516512 | 294 |
| 69 | 3300009826 | Ga0123355_10351298 | Ga0123355_103512982 | 294 |
| 70 | 3300009826 | Ga0123355_10579266 | Ga0123355_105792661 | 294 |
| 71 | 3300038395 | Ga0415639_001305 | Ga0415639_001305_1057_1941 | 294 |
| 72 | 3300042598 | Ga0466701_046500 | Ga0466701_046500_2574_3458 | 294 |
| 73 | 3300042599 | Ga0466706_122429 | Ga0466706_122429_58027_58911 | 294 |
| 74 | 3300042599 | Ga0466706_207135 | Ga0466706_207135_15962_16846 | 294 |
| 75 | 3300042602 | Ga0466713_073679 | Ga0466713_073679_39801_40685 | 294 |
| 76 | 3300042635 | Ga0466702_237244 | Ga0466702_237244_321_1205 | 294 |
| 77 | 3300042635 | Ga0466702_443794 | Ga0466702_443794_9374_10258 | 294 |
| 78 | 3300042659 | Ga0466733_052837 | Ga0466733_052837_6383_7267 | 294 |
| 79 | iso_pr_bacteria | 2590828840 | 2593254848 | 294 |
| 80 | iso_pr_bacteria | 2593339125 | 2595066683 | 294 |
| 81 | iso_pr_bacteria | 2820032565 | 2820033235 | 294 |
| 82 | iso_pr_bacteria | 2820277137 | 2820278385 | 294 |
| 83 | iso_pr_bacteria | 2820282995 | 2820284575 | 294 |
| 84 | iso_pr_bacteria | 2820492969 | 2820494195 | 294 |
| 85 | iso_pr_bacteria | 2820507989 | 2820509815 | 294 |
| 86 | iso_pr_bacteria | 2820512088 | 2820513466 | 294 |
| 87 | iso_pr_bacteria | 2820520043 | 2820520207 | 294 |
| 88 | iso_pr_bacteria | 2820626145 | 2820626303 | 294 |
| 89 | iso_pr_bacteria | 2820671341 | 2820672959 | 294 |
| 90 | iso_pr_bacteria | 2940230426 | 2940233123 | 294 |
| 91 | iso_pr_bacteria | 2940233634 | 2940236308 | 294 |
| 92 | iso_pr_bacteria | 2940264388 | 2940266795 | 294 |
| 93 | iso_pr_bacteria | 2940267548 | 2940269924 | 294 |
| 94 | iso_pr_bacteria | 2940270707 | 2940273084 | 294 |
| 95 | iso_pr_bacteria | 2940273867 | 2940276277 | 294 |
| 96 | iso_pr_bacteria | 2940277027 | 2940279111 | 294 |
| 97 | iso_pr_bacteria | 2940280053 | 2940281917 | 294 |
| 98 | iso_pr_bacteria | 2940283334 | 2940286008 | 294 |
| 99 | iso_pr_bacteria | 2940286528 | 2940288466 | 294 |
| 100 | iso_pr_bacteria | 2940289514 | 2940291117 | 294 |
| 101 | iso_pr_bacteria | 2940292506 | 2940294261 | 294 |
| 102 | iso_pr_bacteria | 2940295490 | 2940296964 | 294 |
| 103 | iso_pr_bacteria | 2944625312 | 2944627172 | 294 |
| 104 | 2225789003 | 2227000114 | 2227353908 | 295 |
| 105 | 3300000062 | IMNBL1DRAFT_c0000460 | IMNBL1DRAFT_00004602 | 295 |
| 106 | 3300000089 | AustNasuHG_c1017443 | AustNasuHG_10174433 | 295 |
| 107 | 3300002450 | JGI24695J34938_10006036 | JGI24695J34938_100060364 | 295 |
| 108 | 3300005083 | Ga0068305_10002195 | Ga0068305_1000219511 | 295 |
| 109 | 3300005083 | Ga0068305_10234975 | Ga0068305_102349752 | 295 |
| 110 | 3300009826 | Ga0123355_10015861 | Ga0123355_100158616 | 295 |
| 111 | 3300009826 | Ga0123355_10016048 | Ga0123355_100160488 | 295 |
| 112 | 3300009826 | Ga0123355_10039386 | Ga0123355_100393865 | 295 |
| 113 | 3300009826 | Ga0123355_10081125 | Ga0123355_100811252 | 295 |
| 114 | 3300038395 | Ga0415639_066400 | Ga0415639_066400_6299_7186 | 295 |
| 115 | 3300038395 | Ga0415639_069395 | Ga0415639_069395_3723_4610 | 295 |
| 116 | 3300042591 | Ga0466692_173925 | Ga0466692_173925_87034_87921 | 295 |
| 117 | 3300042599 | Ga0466706_053647 | Ga0466706_053647_155_1042 | 295 |
| 118 | 3300042599 | Ga0466706_107466 | Ga0466706_107466_1468_2355 | 295 |
| 119 | 3300042599 | Ga0466706_135485 | Ga0466706_135485_145_1032 | 295 |
| 120 | 3300042599 | Ga0466706_177658 | Ga0466706_177658_331_1218 | 295 |
| 121 | 3300042601 | Ga0466707_340158 | Ga0466707_340158_2022_2909 | 295 |
| 122 | 3300042603 | Ga0466714_098456 | Ga0466714_098456_34_921 | 295 |
| 123 | 3300042605 | Ga0466716_480508 | Ga0466716_480508_153_1040 | 295 |
| 124 | 3300042608 | Ga0466721_275466 | Ga0466721_275466_964_1851 | 295 |
| 125 | 3300042609 | Ga0466722_234024 | Ga0466722_234024_1568_2455 | 295 |
| 126 | 3300042609 | Ga0466722_238835 | Ga0466722_238835_6867_7754 | 295 |
| 127 | 3300042610 | Ga0466698_107576 | Ga0466698_107576_123_1010 | 295 |
| 128 | 3300042612 | Ga0466705_396447 | Ga0466705_396447_222_1109 | 295 |
| 129 | 3300042619 | Ga0466726_036168 | Ga0466726_036168_6204_7091 | 295 |
| 130 | 3300042624 | Ga0466735_105457 | Ga0466735_105457_2286_3173 | 295 |
| 131 | 3300042635 | Ga0466702_116525 | Ga0466702_116525_82_969 | 295 |
| 132 | 3300042635 | Ga0466702_324890 | Ga0466702_324890_128_1015 | 295 |
| 133 | 3300042636 | Ga0466703_222245 | Ga0466703_222245_495_1382 | 295 |
| 134 | 3300042636 | Ga0466703_257786 | Ga0466703_257786_11168_12055 | 295 |
| 135 | iso_pr_bacteria | 2820240463 | 2820241091 | 295 |
| 136 | iso_pr_bacteria | 2820488713 | 2820489187 | 295 |
| 137 | iso_pr_bacteria | 2820584674 | 2820586849 | 295 |
| 138 | iso_pr_bacteria | 2820613375 | 2820614010 | 295 |
| 139 | iso_pr_bacteria | 2820646798 | 2820647307 | 295 |
| 140 | 2225789004 | 2227358543 | 2227803524 | 296 |
| 141 | 2225789004 | 2227541878 | 2228064378 | 296 |
| 142 | 3300000062 | IMNBL1DRAFT_c0000009 | IMNBL1DRAFT_0000009208 | 296 |
| 143 | 3300002462 | JGI24702J35022_10000376 | JGI24702J35022_100003764 | 296 |
| 144 | 3300002504 | JGI24705J35276_12238662 | JGI24705J35276_1223866225 | 296 |
| 145 | 3300002834 | JGI24696J40584_12925915 | JGI24696J40584_129259151 | 296 |
| 146 | 3300005201 | Ga0072941_1096920 | Ga0072941_109692026 | 296 |
| 147 | 3300005201 | Ga0072941_1224194 | Ga0072941_12241945 | 296 |
| 148 | 3300009826 | Ga0123355_10002027 | Ga0123355_1000202729 | 296 |
| 149 | 3300009826 | Ga0123355_10013326 | Ga0123355_1001332618 | 296 |
| 150 | 3300009826 | Ga0123355_10197627 | Ga0123355_101976272 | 296 |
| 151 | 3300009826 | Ga0123355_10338348 | Ga0123355_103383482 | 296 |
| 152 | 3300010049 | Ga0123356_10207810 | Ga0123356_102078102 | 296 |
| 153 | 3300010167 | Ga0123353_10012808 | Ga0123353_100128089 | 296 |
| 154 | 3300010167 | Ga0123353_10111527 | Ga0123353_101115274 | 296 |
| 155 | 3300038395 | Ga0415639_167887 | Ga0415639_167887_25_915 | 296 |
| 156 | 3300042592 | Ga0466693_164074 | Ga0466693_164074_72_962 | 296 |
| 157 | 3300042593 | Ga0466691_212677 | Ga0466691_212677_231_1121 | 296 |
| 158 | 3300042596 | Ga0466696_375600 | Ga0466696_375600_1871_2761 | 296 |
| 159 | 3300042599 | Ga0466706_167016 | Ga0466706_167016_396_1286 | 296 |
| 160 | 3300042599 | Ga0466706_202476 | Ga0466706_202476_398_1288 | 296 |
| 161 | 3300042602 | Ga0466713_117950 | Ga0466713_117950_681_1571 | 296 |
| 162 | 3300042606 | Ga0466719_453084 | Ga0466719_453084_1090_1980 | 296 |
| 163 | 3300042610 | Ga0466698_169800 | Ga0466698_169800_926_1816 | 296 |
| 164 | 3300042612 | Ga0466705_278053 | Ga0466705_278053_40461_41351 | 296 |
| 165 | 3300042636 | Ga0466703_093453 | Ga0466703_093453_22068_22958 | 296 |
| 166 | 3300042636 | Ga0466703_343670 | Ga0466703_343670_5002_5892 | 296 |
| 167 | 3300042643 | Ga0466704_103189 | Ga0466704_103189_56340_57230 | 296 |
| 168 | 3300042648 | Ga0466709_374255 | Ga0466709_374255_50022_50912 | 296 |
| 169 | 3300056856 | Ga0562375_2332 | Ga0562375_2332_9397_10287 | 296 |
| 170 | iso_pr_bacteria | 2820280018 | 2820281712 | 296 |
| 171 | iso_pr_bacteria | 2820360414 | 2820361854 | 296 |
| 172 | iso_pr_bacteria | 2820362221 | 2820363674 | 296 |
| 173 | iso_pr_bacteria | 2820406809 | 2820407854 | 296 |
| 174 | iso_pr_bacteria | 2820533259 | 2820533606 | 296 |
| 175 | 2225789004 | 2227141924 | 2227544202 | 297 |
| 176 | 3300000062 | IMNBL1DRAFT_c0000484 | IMNBL1DRAFT_00004846 | 297 |
| 177 | 3300000062 | IMNBL1DRAFT_c0001064 | IMNBL1DRAFT_000106421 | 297 |
| 178 | 3300002504 | JGI24705J35276_12230352 | JGI24705J35276_122303524 | 297 |
| 179 | 3300009784 | Ga0123357_10215037 | Ga0123357_102150373 | 297 |
| 180 | 3300010167 | Ga0123353_10003607 | Ga0123353_1000360710 | 297 |
| 181 | 3300010167 | Ga0123353_10516934 | Ga0123353_105169342 | 297 |
| 182 | 3300010882 | Ga0123354_10000235 | Ga0123354_100002355 | 297 |
| 183 | 3300010882 | Ga0123354_10041469 | Ga0123354_100414692 | 297 |
| 184 | 3300042599 | Ga0466706_102143 | Ga0466706_102143_327_1220 | 297 |
| 185 | 3300042603 | Ga0466714_167736 | Ga0466714_167736_3167_4060 | 297 |
| 186 | 3300042615 | Ga0466711_257953 | Ga0466711_257953_1696_2589 | 297 |
| 187 | 3300042655 | Ga0466727_164564 | Ga0466727_164564_721_1614 | 297 |
| 188 | iso_pr_bacteria | 2820229114 | 2820229369 | 297 |
| 189 | 2225789004 | 2227646814 | 2228239200 | 298 |
| 190 | 3300000062 | IMNBL1DRAFT_c0000220 | IMNBL1DRAFT_000022031 | 298 |
| 191 | 3300002462 | JGI24702J35022_10004279 | JGI24702J35022_1000427910 | 298 |
| 192 | 3300005083 | Ga0068305_10005230 | Ga0068305_100052307 | 298 |
| 193 | 3300010167 | Ga0123353_10230697 | Ga0123353_102306972 | 298 |
| 194 | 3300042599 | Ga0466706_046179 | Ga0466706_046179_472_1368 | 298 |
| 195 | 3300042643 | Ga0466704_322452 | Ga0466704_322452_1130_2026 | 298 |
| 196 | iso_pr_bacteria | 2820516196 | 2820516469 | 298 |
| 197 | 3300000062 | IMNBL1DRAFT_c0000060 | IMNBL1DRAFT_000006079 | 299 |
| 198 | 3300010049 | Ga0123356_10065942 | Ga0123356_100659422 | 299 |
| 199 | 3300042616 | Ga0466715_645092 | Ga0466715_645092_9819_10718 | 299 |
| 200 | 3300042649 | Ga0466724_58988 | Ga0466724_58988_2009_2938 | 299 |
| 201 | 3300042619 | Ga0466726_471877 | Ga0466726_471877_25859_26761 | 300 |
| 202 | 3300042635 | Ga0466702_284954 | Ga0466702_284954_349_1251 | 300 |
| 203 | 3300042592 | Ga0466693_359963 | Ga0466693_359963_18_926 | 302 |
| 204 | 3300042599 | Ga0466706_201942 | Ga0466706_201942_7607_8515 | 302 |
| 205 | 3300042600 | Ga0466700_466547 | Ga0466700_466547_136_1044 | 302 |
| 206 | 3300010167 | Ga0123353_10205495 | Ga0123353_102054951 | 303 |
| 207 | 3300042599 | Ga0466706_173612 | Ga0466706_173612_3858_4769 | 303 |
| 208 | 3300042601 | Ga0466707_080023 | Ga0466707_080023_9688_10602 | 304 |
| 209 | 3300042602 | Ga0466713_137279 | Ga0466713_137279_1762_2676 | 304 |
| 210 | 3300042616 | Ga0466715_483797 | Ga0466715_483797_37333_38247 | 304 |
| 211 | 3300042648 | Ga0466709_368918 | Ga0466709_368918_60522_61436 | 304 |
| 212 | 3300042599 | Ga0466706_194038 | Ga0466706_194038_2415_3335 | 306 |
| 213 | 3300042622 | Ga0466731_350380 | Ga0466731_350380_351_1277 | 308 |
| 214 | 3300042601 | Ga0466707_241097 | Ga0466707_241097_2717_3646 | 309 |
| 215 | 3300009826 | Ga0123355_10386067 | Ga0123355_103860671 | 310 |
| 216 | 3300010167 | Ga0123353_10176507 | Ga0123353_101765074 | 311 |
| 217 | 3300042654 | Ga0466725_203071 | Ga0466725_203071_81_1016 | 311 |
| 218 | 3300042599 | Ga0466706_158567 | Ga0466706_158567_10831_11775 | 314 |
| 219 | 3300042616 | Ga0466715_483763 | Ga0466715_483763_15764_16708 | 314 |
| 220 | 3300010167 | Ga0123353_10021843 | Ga0123353_100218433 | 317 |
| 221 | 3300009826 | Ga0123355_10000370 | Ga0123355_1000037033 | 318 |
| 222 | 3300010167 | Ga0123353_10000639 | Ga0123353_100006392 | 318 |
| 223 | 3300042606 | Ga0466719_269104 | Ga0466719_269104_4967_5941 | 324 |
| 224 | 3300042604 | Ga0466717_259684 | Ga0466717_259684_1083_2141 | 352 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00701 | DHDPS | Dihydrodipicolinate synthetase family | 61 | 346 | 0.99 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00701 | GO:0016829 | lyase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.