Protein Family IF06266

Metagenome Metatranscriptome Isolate
136 Members
51 Samples
119 Scaffolds
112.49 Avg Length

🧬 Representative Sequence

ID
3300042604|Ga0466717_125060|Ga0466717_125060_418_810
Length
130 aa
Sequence
VSVKFSNKNVAKKSVKLHVKTGDTVVLLTGKYKDKFSKPGVRKTGKVVGVSPKEGKVIVEGINKVKKHVKPRRAGEPGGIIDAEAPIYACKVQVVCPKCDKPTRVGHGFKEVKGKTVKVRICKKCGKEID

📊 Sample Types

Isolate 12.5%
Metagenome 85.3%
MAG 0.0%
Metatranscriptome 2.2%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 36.0%
Termitidae 36.0%
Kalotermitidae 18.0%
Passalidae 4.0%
Termopsidae 2.0%
Hodotermitidae 2.0%
Apidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
13 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
14 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
15 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
16 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
17 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
18 3300021240 Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA Metatranscriptome Termitidae
19 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
20 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 3300021237 Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA Metatranscriptome
27 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
28 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
29 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
30 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
34 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
35 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
36 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
37 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
38 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
45 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
48 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
49 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
50 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
51 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0223675_1033352 3300021237 Bacteria 1048
2 Ga0415639_001087 3300038395 Bacteria 37853
3 Ga0123355_10297031 3300009826 Bacteria 2208
4 Ga0123355_10349552 3300009826 Bacteria 1960
5 Ga0123355_10485176 3300009826 Bacteria 1535
6 Ga0123355_10548431 3300009826 Bacteria 1399
7 Ga0123356_10000028 3300010049 Bacteria 164875
8 Ga0123356_10075868 3300010049 Bacteria 3167
9 Ga0123356_11359798 3300010049 Bacteria 872
10 Ga0123356_11539559 3300010049 Bacteria 821
11 Ga0123356_13749558 3300010049 Bacteria 525
12 Ga0123353_10595986 3300010167 Bacteria 1581
13 Ga0123353_10660638 3300010167 Bacteria 1477
14 Ga0123354_10138730 3300010882 Bacteria 3023
15 Ga0466706_269670 3300042599 Bacteria 79639
16 Ga0466721_147266 3300042608 Bacteria 1195
17 Ga0466698_337884 3300042610 Bacteria 12427
18 AustNasuHG_c1000039 3300000089 Bacteria 32381
19 Ga0233288_1017964 3300022232 Bacteria 2320
20 Ga0415639_121180 3300038395 Bacteria 3675
21 Ga0123355_10002185 3300009826 Bacteria 27609
22 Ga0123355_10276546 3300009826 Bacteria 2324
23 Ga0123356_13495359 3300010049 Bacteria 545
24 Ga0123353_10012761 3300010167 Bacteria 11980
25 Ga0123353_10957124 3300010167 Bacteria 1157
26 Ga0466706_100462 3300042599 Bacteria 36169
27 Ga0466714_094629 3300042603 Bacteria 1559
28 Ga0466709_171547 3300042648 Bacteria 83571
29 Ga0466733_130542 3300042659 Bacteria 2239
30 Ga0466696_498562 3300042596 Bacteria 15998
31 Ga0123355_10077171 3300009826 Bacteria 5326
32 Ga0123355_10137124 3300009826 Bacteria 3755
33 Ga0123355_10410645 3300009826 Bacteria 1738
34 Ga0123355_11665138 3300009826 Bacteria 610
35 Ga0123356_10204096 3300010049 Unclassified 2019
36 Ga0123356_10218072 3300010049 Bacteria 1962
37 Ga0123353_10913744 3300010167 Bacteria 1193
38 Ga0123353_12949044 3300010167 Bacteria 553
39 Ga0466706_123050 3300042599 Bacteria 2733
40 Ga0466700_321744 3300042600 Bacteria 1581
41 Ga0466717_125060 3300042604 Bacteria 2040
42 Ga0466717_289737 3300042604 Bacteria 1024
43 Ga0466698_428023 3300042610 Bacteria 1317
44 2227505172 2225789004 Bacteria 19004
45 Ga0072940_1122816 3300005200 Bacteria 2618
46 Ga0072940_1383219 3300005200 Bacteria 893
47 Ga0466703_190061 3300042636 Bacteria 90552
48 Ga0466733_028737 3300042659 Bacteria 2352
49 Ga0415639_007671 3300038395 Bacteria 5926
50 Ga0415639_020367 3300038395 Bacteria 13306
51 Ga0123355_10202642 3300009826 Bacteria 2894
52 Ga0123355_11654190 3300009826 Bacteria 613
53 Ga0123356_10102388 3300010049 Bacteria 2749
54 Ga0123353_10000033 3300010167 Bacteria 150421
55 Ga0123353_10007664 3300010167 Bacteria 14629
56 Ga0123353_11855508 3300010167 Bacteria 746
57 Ga0123353_12394458 3300010167 Bacteria 632
58 Ga0466717_261825 3300042604 Bacteria 1083
59 Ga0466721_218303 3300042608 Bacteria 3036
60 2227459968 2225789004 Unclassified 1004
61 IMNBL1DRAFT_c0001685 3300000062 Bacteria 16309
62 Ga0072940_1122815 3300005200 Bacteria 5983
63 Ga0466704_322227 3300042643 Bacteria 202158
64 Ga0466733_215673 3300042659 Bacteria 10596
65 Ga0415639_170993 3300038395 Bacteria 1155
66 Ga0123356_11682661 3300010049 Bacteria 787
67 Ga0466707_329910 3300042601 Bacteria 3613
68 Ga0466714_122492 3300042603 Bacteria 2757
69 2227469098 2225789004 Bacteria 4980
70 JGI24703J35330_11748856 3300002501 Bacteria 55836
71 Ga0068305_10005402 3300005083 Bacteria 29409
72 Ga0466715_155843 3300042616 Bacteria 19455
73 Ga0466702_447794 3300042635 Bacteria 1991
74 Ga0466733_188704 3300042659 Bacteria 2246
75 Ga0415639_007670 3300038395 Bacteria 6074
76 Ga0415639_019174 3300038395 Bacteria 27021
77 Ga0415639_101338 3300038395 Bacteria 1061
78 Ga0123355_10439067 3300009826 Bacteria 1654
79 Ga0123355_10639348 3300009826 Bacteria 1246
80 Ga0123355_11828410 3300009826 Unclassified 572
81 Ga0123356_10145829 3300010049 Bacteria 2342
82 Ga0123356_11914877 3300010049 Unclassified 738
83 Ga0123356_13643137 3300010049 Bacteria 533
84 Ga0123353_10230863 3300010167 Bacteria 2885
85 Ga0123353_11296389 3300010167 Bacteria 946
86 Ga0123353_13364003 3300010167 Bacteria 508
87 Ga0466706_215819 3300042599 Bacteria 3628
88 IMNBL1DRAFT_c0003704 3300000062 Bacteria 9614
89 Ga0068302_10222330 3300005071 Bacteria 1640
90 Ga0466710_395115 3300042613 Bacteria 1440
91 Ga0466702_180988 3300042635 Bacteria 12693
92 Ga0223684_1088824 3300021240 Bacteria 702
93 Ga0415639_012149 3300038395 Bacteria 25902
94 Ga0415639_065900 3300038395 Bacteria 3879
95 Ga0466691_066147 3300042593 Bacteria 2053
96 Ga0466696_296201 3300042596 Bacteria 26567
97 Ga0123355_10938058 3300009826 Bacteria 932
98 Ga0123356_10005392 3300010049 Bacteria 13028
99 Ga0123356_13236283 3300010049 Unclassified 567
100 Ga0123353_10005887 3300010167 Bacteria 16213
101 Ga0123353_10013104 3300010167 Bacteria 11852
102 Ga0123353_10503773 3300010167 Bacteria 1763
103 Ga0123353_10836425 3300010167 Bacteria 1264
104 Ga0466716_079119 3300042605 Bacteria 3655
105 Ga0466719_201247 3300042606 Bacteria 254275
106 IMNBL1DRAFT_c0001208 3300000062 Bacteria 19538
107 Ga0466715_584084 3300042616 Bacteria 48896
108 Ga0123355_10871362 3300009826 Bacteria 986
109 Ga0123356_10233862 3300010049 Bacteria 1904
110 Ga0123356_10246161 3300010049 Bacteria 1862
111 Ga0123356_11101699 3300010049 Bacteria 962
112 Ga0123356_11802553 3300010049 Bacteria 761
113 Ga0466706_284824 3300042599 Bacteria 3250
114 Ga0466700_448226 3300042600 Bacteria 2117
115 Ga0466714_034189 3300042603 Bacteria 4534
116 Ga0466721_171853 3300042608 Bacteria 2182
117 Ga0072940_1122814 3300005200 Bacteria 2972
118 Ga0466728_184948 3300042620 Bacteria 2550
119 Ga0466702_125533 3300042635 Bacteria 57100

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10485176 Ga0123355_104851763 90
2 3300009826 Ga0123355_10297031 Ga0123355_102970315 98
3 3300038395 Ga0415639_170993 Ga0415639_170993_100_444 99
4 3300010049 Ga0123356_11914877 Ga0123356_119148772 101
5 3300010167 Ga0123353_10660638 Ga0123353_106606382 101
6 3300005071 Ga0068302_10222330 Ga0068302_102223305 102
7 3300009826 Ga0123355_10202642 Ga0123355_102026425 103
8 3300009826 Ga0123355_10276546 Ga0123355_102765462 103
9 3300009826 Ga0123355_10938058 Ga0123355_109380582 103
10 3300042606 Ga0466719_201247 Ga0466719_201247_77386_77700 104
11 iso_pr_bacteria 2820259584 2820260968 104
12 3300042593 Ga0466691_066147 Ga0466691_066147_967_1284 105
13 3300042596 Ga0466696_296201 Ga0466696_296201_18360_18677 105
14 3300042599 Ga0466706_269670 Ga0466706_269670_23180_23497 105
15 3300042643 Ga0466704_322227 Ga0466704_322227_188919_189236 105
16 iso_pr_bacteria 2820271343 2820271681 105
17 iso_pr_bacteria 2820596822 2820598579 105
18 2225789004 2227459968 2227895484 106
19 3300000062 IMNBL1DRAFT_c0001208 IMNBL1DRAFT_000120817 106
20 3300010049 Ga0123356_11682661 Ga0123356_116826612 106
21 3300010167 Ga0123353_11296389 Ga0123353_112963892 106
22 3300042596 Ga0466696_498562 Ga0466696_498562_13890_14210 106
23 3300042599 Ga0466706_123050 Ga0466706_123050_1108_1428 106
24 3300042599 Ga0466706_215819 Ga0466706_215819_989_1327 106
25 3300042605 Ga0466716_079119 Ga0466716_079119_1442_1762 106
26 3300042616 Ga0466715_155843 Ga0466715_155843_11183_11503 106
27 3300042636 Ga0466703_190061 Ga0466703_190061_78302_78622 106
28 iso_pr_bacteria 2820447167 2820447626 106
29 3300000062 IMNBL1DRAFT_c0003704 IMNBL1DRAFT_000370416 107
30 3300010167 Ga0123353_10012761 Ga0123353_1001276115 107
31 3300010167 Ga0123353_10230863 Ga0123353_102308636 107
32 3300010167 Ga0123353_10957124 Ga0123353_109571243 107
33 3300010167 Ga0123353_11855508 Ga0123353_118555082 107
34 3300010167 Ga0123353_12949044 Ga0123353_129490442 107
35 3300021237 Ga0223675_1033352 Ga0223675_10333522 107
36 3300042603 Ga0466714_094629 Ga0466714_094629_485_808 107
37 2225789004 2227505172 2227991941 108
38 3300010049 Ga0123356_11359798 Ga0123356_113597982 108
39 3300010049 Ga0123356_11539559 Ga0123356_115395592 108
40 3300010167 Ga0123353_10013104 Ga0123353_1001310418 108
41 3300010167 Ga0123353_13364003 Ga0123353_133640032 108
42 3300010882 Ga0123354_10138730 Ga0123354_101387307 108
43 3300021240 Ga0223684_1088824 Ga0223684_10888242 108
44 3300042603 Ga0466714_122492 Ga0466714_122492_883_1209 108
45 3300042610 Ga0466698_337884 Ga0466698_337884_3644_3970 108
46 3300042613 Ga0466710_395115 Ga0466710_395115_626_952 108
47 iso_pr_bacteria 2820280018 2820280719 108
48 iso_pr_bacteria 2820420508 2820420941 108
49 3300000062 IMNBL1DRAFT_c0001685 IMNBL1DRAFT_000168513 109
50 3300010167 Ga0123353_10005887 Ga0123353_1000588718 109
51 3300010167 Ga0123353_10007664 Ga0123353_1000766418 109
52 3300042616 Ga0466715_584084 Ga0466715_584084_28617_28946 109
53 3300042659 Ga0466733_215673 Ga0466733_215673_6417_6746 109
54 iso_pr_bacteria 2820483401 2820484122 109
55 3300009826 Ga0123355_10002185 Ga0123355_1000218523 110
56 3300009826 Ga0123355_10077171 Ga0123355_1007717110 110
57 3300009826 Ga0123355_10137124 Ga0123355_101371244 110
58 3300009826 Ga0123355_10871362 Ga0123355_108713622 110
59 3300009826 Ga0123355_11654190 Ga0123355_116541902 110
60 3300009826 Ga0123355_11665138 Ga0123355_116651382 110
61 3300010167 Ga0123353_10000033 Ga0123353_1000003344 110
62 iso_pr_bacteria 2820504582 2820506459 110
63 3300005200 Ga0072940_1122814 Ga0072940_11228146 111
64 3300010167 Ga0123353_10595986 Ga0123353_105959864 111
65 3300009826 Ga0123355_10439067 Ga0123355_104390672 112
66 3300009826 Ga0123355_10548431 Ga0123355_105484313 112
67 3300042600 Ga0466700_448226 Ga0466700_448226_1756_2094 112
68 3300042608 Ga0466721_147266 Ga0466721_147266_529_867 112
69 3300042620 Ga0466728_184948 Ga0466728_184948_1611_1949 112
70 3300042659 Ga0466733_130542 Ga0466733_130542_796_1134 112
71 3300042659 Ga0466733_188704 Ga0466733_188704_440_778 112
72 iso_pr_bacteria 8065497608 8065499076 112
73 3300010049 Ga0123356_13236283 Ga0123356_132362832 113
74 3300010049 Ga0123356_13643137 Ga0123356_136431372 113
75 3300010167 Ga0123353_10836425 Ga0123353_108364252 113
76 3300042635 Ga0466702_447794 Ga0466702_447794_381_722 113
77 iso_pr_bacteria 2820242869 2820242990 113
78 3300010049 Ga0123356_10246161 Ga0123356_102461612 114
79 3300010049 Ga0123356_11802553 Ga0123356_118025532 114
80 3300010167 Ga0123353_10913744 Ga0123353_109137442 114
81 3300005083 Ga0068305_10005402 Ga0068305_1000540217 115
82 3300010049 Ga0123356_10233862 Ga0123356_102338622 115
83 3300042600 Ga0466700_321744 Ga0466700_321744_385_732 115
84 3300042635 Ga0466702_125533 Ga0466702_125533_29654_30001 115
85 3300042635 Ga0466702_180988 Ga0466702_180988_11768_12115 115
86 iso_pr_bacteria 2820288918 2820289871 115
87 3300038395 Ga0415639_007670 Ga0415639_007670_453_803 116
88 3300038395 Ga0415639_007671 Ga0415639_007671_1112_1462 116
89 3300038395 Ga0415639_065900 Ga0415639_065900_2409_2759 116
90 3300042599 Ga0466706_100462 Ga0466706_100462_3609_3959 116
91 3300042608 Ga0466721_218303 Ga0466721_218303_2068_2418 116
92 3300042610 Ga0466698_428023 Ga0466698_428023_706_1056 116
93 iso_pr_bacteria 2820255904 2820255968 116
94 iso_pr_bacteria 2820319488 2820319604 116
95 iso_pr_bacteria 2820339298 2820339506 116
96 iso_pr_bacteria 2820360414 2820361178 116
97 iso_pr_bacteria 2820570671 2820571581 116
98 3300009826 Ga0123355_11828410 Ga0123355_118284101 117
99 3300010049 Ga0123356_10000028 Ga0123356_1000002836 117
100 3300010049 Ga0123356_10102388 Ga0123356_101023886 117
101 3300010049 Ga0123356_10204096 Ga0123356_102040962 117
102 3300010049 Ga0123356_10218072 Ga0123356_102180722 117
103 3300010049 Ga0123356_11101699 Ga0123356_111016992 117
104 3300042599 Ga0466706_284824 Ga0466706_284824_321_674 117
105 3300042603 Ga0466714_034189 Ga0466714_034189_2791_3144 117
106 3300042648 Ga0466709_171547 Ga0466709_171547_65370_65723 117
107 iso_pr_bacteria 2820387566 2820389107 117
108 3300000089 AustNasuHG_c1000039 AustNasuHG_100003928 118
109 3300002501 JGI24703J35330_11748856 JGI24703J35330_1174885629 118
110 3300005200 Ga0072940_1122815 Ga0072940_112281511 118
111 3300005200 Ga0072940_1122816 Ga0072940_11228165 118
112 3300005200 Ga0072940_1383219 Ga0072940_13832192 118
113 3300010049 Ga0123356_10145829 Ga0123356_101458295 118
114 3300010167 Ga0123353_10503773 Ga0123353_105037734 118
115 3300042601 Ga0466707_329910 Ga0466707_329910_3157_3513 118
116 2225789004 2227469098 2227912559 119
117 3300038395 Ga0415639_001087 Ga0415639_001087_31279_31638 119
118 3300042604 Ga0466717_289737 Ga0466717_289737_498_857 119
119 3300042659 Ga0466733_028737 Ga0466733_028737_213_572 119
120 3300010049 Ga0123356_13495359 Ga0123356_134953591 120
121 3300038395 Ga0415639_020367 Ga0415639_020367_563_925 120
122 3300038395 Ga0415639_012149 Ga0415639_012149_24791_25156 121
123 3300038395 Ga0415639_101338 Ga0415639_101338_327_692 121
124 3300038395 Ga0415639_121180 Ga0415639_121180_3141_3506 121
125 3300009826 Ga0123355_10349552 Ga0123355_103495523 122
126 3300009826 Ga0123355_10410645 Ga0123355_104106452 122
127 3300010049 Ga0123356_10005392 Ga0123356_100053926 122
128 3300010049 Ga0123356_10075868 Ga0123356_100758686 126
129 3300038395 Ga0415639_019174 Ga0415639_019174_11180_11566 128
130 3300042604 Ga0466717_261825 Ga0466717_261825_265_672 128
131 3300009826 Ga0123355_10639348 Ga0123355_106393482 129
132 3300010049 Ga0123356_13749558 Ga0123356_137495581 129
133 3300022232 Ga0233288_1017964 Ga0233288_10179645 129
134 3300042608 Ga0466721_171853 Ga0466721_171853_1669_2058 129
135 3300010167 Ga0123353_12394458 Ga0123353_123944582 130
136 3300042604 Ga0466717_125060 Ga0466717_125060_418_810 130

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17136 ribosomal_L24 Ribosomal proteins 50S L24/mitochondrial 39S L24 62 129 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.