Protein Family IF06217

Metagenome Isolate
111 Members
43 Samples
107 Scaffolds
328.56 Avg Length

🧬 Representative Sequence

ID
3300042603|Ga0466714_121005|Ga0466714_121005_58_1074
Length
338 aa
Sequence
MNIGNIDLGARPLLLAPMEDVTDRSFRAMCKGFGADMVYTEFISSDGLIRDAAKSLAKLRLEDDERPVGVQIYGHLIEPMVEAARMAESAHPDVIDINFGCPVKKIANRGAGSGMMREPDKMVEMTRRIVDAIGGRVPVTVKTRLGWDENSKNIEELAVRLQDTGIAALTIHGRTRAQLYKGEADWTLIGAVKANPAIHIPIIGNGDISSPEGALQAFEHWGVDGVMIGRATYGRPWIFREIKHYLATGDLLPQPGVTERVEIARRHLLKSIEVKGEKVGILEMRRHLSSYFKGLPDFKATRLALVTENDPAELLRTLNTIADRWGTCDMSTTIPKLW

📊 Sample Types

Isolate 3.6%
Metagenome 96.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 33.3%
Termitidae 28.6%
Unclassified 14.3%
Rhinotermitidae 7.1%
Termopsidae 7.1%
Passalidae 4.8%
Armadillidiidae 2.4%
Hodotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
3 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
4 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
5 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
6 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
7 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
15 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
16 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
34 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
38 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_200811 3300042612 Bacteria 28689
2 Ga0466733_199714 3300042659 Bacteria 1378
3 Ga0466696_131205 3300042596 Bacteria 6038
4 Ga0466735_106211 3300042624 Bacteria 5340
5 Ga0466704_329161 3300042643 Bacteria 13717
6 Ga0466709_116749 3300042648 Bacteria 5788
7 Ga0466714_024607 3300042603 Bacteria 3505
8 Ga0466716_278916 3300042605 Bacteria 5730
9 Ga0466712_164773 3300042614 Bacteria 4171
10 Ga0123353_10839990 3300010167 Bacteria 1261
11 IMNBL1DRAFT_c0000765 3300000062 Bacteria 25410
12 Ga0466733_104669 3300042659 Bacteria 2363
13 Ga0160433_100003 3300012846 Bacteria 588956
14 Ga0466690_082225 3300042590 Bacteria 3385
15 Ga0466735_019897 3300042624 Bacteria 1835
16 Ga0466706_027307 3300042599 Bacteria 8243
17 Ga0466706_243833 3300042599 Bacteria 35703
18 Ga0466707_104252 3300042601 Bacteria 29636
19 Ga0466714_121005 3300042603 Bacteria 1417
20 Ga0466719_135924 3300042606 Bacteria 3463
21 Ga0466719_447284 3300042606 Bacteria 1365
22 Ga0466719_569598 3300042606 Bacteria 1522
23 Ga0466723_026766 3300042618 Bacteria 20254
24 Ga0466726_297935 3300042619 Bacteria 15869
25 Ga0123353_10100014 3300010167 Bacteria 4674
26 Ga0123354_10059988 3300010882 Bacteria 5636
27 Ga0466733_215256 3300042659 Bacteria 12452
28 Ga0466690_086439 3300042590 Bacteria 16955
29 Ga0466690_130420 3300042590 Bacteria 14691
30 Ga0466735_113613 3300042624 Bacteria 55484
31 Ga0466709_306520 3300042648 Bacteria 32391
32 Ga0466727_171731 3300042655 Bacteria 7273
33 Ga0466714_139388 3300042603 Bacteria 2961
34 Ga0466714_145613 3300042603 Bacteria 8089
35 Ga0466719_338690 3300042606 Bacteria 10986
36 Ga0466711_035243 3300042615 Bacteria 2887
37 Ga0466711_262846 3300042615 Bacteria 4229
38 Ga0466726_136512 3300042619 Bacteria 5622
39 Ga0466728_096900 3300042620 Bacteria 18697
40 Ga0123353_10289739 3300010167 Bacteria 2507
41 Ga0466732_394282 3300042656 Bacteria 3674
42 Ga0466733_140048 3300042659 Bacteria 2199
43 Ga0466692_148599 3300042591 Bacteria 25005
44 Ga0466691_013740 3300042593 Bacteria 7144
45 Ga0466695_011493 3300042595 Bacteria 7966
46 Ga0466696_068321 3300042596 Bacteria 30966
47 Ga0466696_444554 3300042596 Bacteria 19303
48 Ga0466703_057883 3300042636 Bacteria 1935
49 Ga0466703_164345 3300042636 Bacteria 2913
50 Ga0466704_182939 3300042643 Bacteria 26244
51 Ga0466709_253747 3300042648 Bacteria 11213
52 Ga0466706_189508 3300042599 Bacteria 6205
53 Ga0466713_090832 3300042602 Bacteria 1746
54 Ga0466722_024855 3300042609 Bacteria 3371
55 Ga0466715_394361 3300042616 Bacteria 29774
56 2227080791 2225789004 Bacteria 41979
57 Ga0466733_220562 3300042659 Bacteria 26223
58 Ga0466692_090043 3300042591 Bacteria 13167
59 Ga0466691_031362 3300042593 Bacteria 18999
60 Ga0466691_060058 3300042593 Bacteria 6144
61 Ga0466696_469704 3300042596 Bacteria 17887
62 Ga0466708_329587 3300042652 Bacteria 27124
63 Ga0466727_103024 3300042655 Bacteria 46807
64 Ga0466706_167981 3300042599 Bacteria 2047
65 Ga0466706_241205 3300042599 Bacteria 7752
66 Ga0466714_106262 3300042603 Bacteria 5677
67 Ga0466714_114517 3300042603 Unclassified 1728
68 Ga0466710_217192 3300042613 Bacteria 1107
69 Ga0466723_050572 3300042618 Bacteria 48539
70 Ga0466723_088812 3300042618 Bacteria 33295
71 Ga0466728_043092 3300042620 Bacteria 5634
72 JGI24705J35276_12233962 3300002504 Bacteria 5166
73 Ga0072941_1057410 3300005201 Bacteria 4618
74 Ga0466733_077031 3300042659 Bacteria 1828
75 Ga0466657_022404 3300042582 Bacteria 1458
76 Ga0466708_286335 3300042652 Bacteria 16948
77 Ga0466727_331606 3300042655 Bacteria 3674
78 Ga0466706_082540 3300042599 Bacteria 29832
79 Ga0466706_271736 3300042599 Bacteria 20455
80 Ga0466716_327426 3300042605 Unclassified 3177
81 Ga0466698_274738 3300042610 Bacteria 1259
82 Ga0466705_499005 3300042612 Bacteria 6837
83 Ga0466711_374933 3300042615 Bacteria 11087
84 Ga0466723_082619 3300042618 Bacteria 11941
85 Ga0466726_397794 3300042619 Bacteria 2189
86 JGI24702J35022_10000040 3300002462 Bacteria 53566
87 Ga0072941_1125529 3300005201 Bacteria 8566
88 Ga0466705_037266 3300042612 Bacteria 15010
89 Ga0466690_166181 3300042590 Bacteria 6899
90 Ga0466696_376429 3300042596 Unclassified 3820
91 Ga0466706_270551 3300042599 Bacteria 39934
92 Ga0466715_396858 3300042616 Bacteria 5135
93 Ga0466729_117836 3300042621 Bacteria 8278
94 Ga0123353_10422217 3300010167 Bacteria 1975
95 Ga0123354_10155126 3300010882 Bacteria 2751
96 Ga0466690_104609 3300042590 Bacteria 7141
97 Ga0466691_111772 3300042593 Bacteria 94015
98 Ga0466691_200204 3300042593 Bacteria 12641
99 Ga0466703_077266 3300042636 Bacteria 1275
100 Ga0466714_163280 3300042603 Bacteria 2218
101 Ga0466716_154063 3300042605 Bacteria 2465
102 Ga0466711_084790 3300042615 Bacteria 9381
103 Ga0466715_363781 3300042616 Bacteria 3940
104 Ga0466723_207102 3300042618 Bacteria 16383
105 Ga0466728_286718 3300042620 Bacteria 11512
106 Ga0466729_156825 3300042621 Bacteria 2537
107 IMNBL1DRAFT_c0001903 3300000062 Bacteria 15106

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_166181 Ga0466690_166181_1137_2066 309
2 3300042618 Ga0466723_207102 Ga0466723_207102_9832_10761 309
3 3300012846 Ga0160433_100003 Ga0160433_100003253 311
4 3300042636 Ga0466703_057883 Ga0466703_057883_700_1635 311
5 3300042601 Ga0466707_104252 Ga0466707_104252_2941_3894 317
6 3300042609 Ga0466722_024855 Ga0466722_024855_1881_2843 320
7 3300042610 Ga0466698_274738 Ga0466698_274738_108_1070 320
8 3300042603 Ga0466714_024607 Ga0466714_024607_2420_3391 323
9 3300042603 Ga0466714_114517 Ga0466714_114517_393_1364 323
10 2225789004 2227080791 2227454114 324
11 3300042582 Ga0466657_022404 Ga0466657_022404_35_1009 324
12 3300042590 Ga0466690_082225 Ga0466690_082225_265_1239 324
13 3300042593 Ga0466691_060058 Ga0466691_060058_1738_2712 324
14 3300042593 Ga0466691_200204 Ga0466691_200204_3828_4802 324
15 3300042596 Ga0466696_131205 Ga0466696_131205_2982_3956 324
16 3300042596 Ga0466696_376429 Ga0466696_376429_2503_3477 324
17 3300042603 Ga0466714_145613 Ga0466714_145613_5278_6252 324
18 3300042605 Ga0466716_327426 Ga0466716_327426_987_1961 324
19 3300042606 Ga0466719_338690 Ga0466719_338690_4142_5116 324
20 3300042606 Ga0466719_569598 Ga0466719_569598_342_1316 324
21 3300042612 Ga0466705_200811 Ga0466705_200811_21407_22381 324
22 3300042613 Ga0466710_217192 Ga0466710_217192_10_984 324
23 3300042615 Ga0466711_262846 Ga0466711_262846_20_994 324
24 3300042615 Ga0466711_374933 Ga0466711_374933_8660_9634 324
25 3300042618 Ga0466723_026766 Ga0466723_026766_6667_7641 324
26 3300042618 Ga0466723_050572 Ga0466723_050572_2146_3120 324
27 3300042621 Ga0466729_117836 Ga0466729_117836_5698_6672 324
28 3300042636 Ga0466703_077266 Ga0466703_077266_70_1044 324
29 3300042643 Ga0466704_182939 Ga0466704_182939_20787_21761 324
30 3300042643 Ga0466704_329161 Ga0466704_329161_11505_12479 324
31 3300042648 Ga0466709_116749 Ga0466709_116749_3170_4144 324
32 3300042648 Ga0466709_253747 Ga0466709_253747_3949_4923 324
33 3300042648 Ga0466709_306520 Ga0466709_306520_20578_21552 324
34 3300042652 Ga0466708_329587 Ga0466708_329587_4088_5062 324
35 3300042655 Ga0466727_103024 Ga0466727_103024_19316_20290 324
36 3300042655 Ga0466727_331606 Ga0466727_331606_2599_3573 324
37 3300042656 Ga0466732_394282 Ga0466732_394282_977_1951 324
38 3300042659 Ga0466733_104669 Ga0466733_104669_1312_2286 324
39 3300042659 Ga0466733_140048 Ga0466733_140048_284_1258 324
40 3300000062 IMNBL1DRAFT_c0000765 IMNBL1DRAFT_00007655 325
41 3300002504 JGI24705J35276_12233962 JGI24705J35276_122339622 325
42 3300005201 Ga0072941_1057410 Ga0072941_10574104 325
43 3300010167 Ga0123353_10422217 Ga0123353_104222172 325
44 3300010167 Ga0123353_10839990 Ga0123353_108399901 325
45 3300010882 Ga0123354_10059988 Ga0123354_100599883 325
46 3300010882 Ga0123354_10155126 Ga0123354_101551262 325
47 3300042590 Ga0466690_086439 Ga0466690_086439_12126_13103 325
48 3300042615 Ga0466711_035243 Ga0466711_035243_667_1644 325
49 3300042618 Ga0466723_082619 Ga0466723_082619_8891_9868 325
50 3300042624 Ga0466735_113613 Ga0466735_113613_53316_54293 325
51 3300042591 Ga0466692_148599 Ga0466692_148599_18777_19757 326
52 3300042593 Ga0466691_013740 Ga0466691_013740_2869_3849 326
53 3300042593 Ga0466691_111772 Ga0466691_111772_155_1135 326
54 3300042596 Ga0466696_068321 Ga0466696_068321_29097_30077 326
55 3300042612 Ga0466705_037266 Ga0466705_037266_9944_10924 326
56 3300042618 Ga0466723_088812 Ga0466723_088812_21655_22635 326
57 3300042619 Ga0466726_397794 Ga0466726_397794_394_1374 326
58 3300042624 Ga0466735_019897 Ga0466735_019897_516_1496 326
59 3300042652 Ga0466708_286335 Ga0466708_286335_326_1306 326
60 3300042655 Ga0466727_171731 Ga0466727_171731_3363_4343 326
61 3300000062 IMNBL1DRAFT_c0001903 IMNBL1DRAFT_00019038 327
62 3300010167 Ga0123353_10289739 Ga0123353_102897393 327
63 3300042593 Ga0466691_031362 Ga0466691_031362_16032_17015 327
64 3300042595 Ga0466695_011493 Ga0466695_011493_4064_5047 327
65 3300042596 Ga0466696_469704 Ga0466696_469704_5411_6394 327
66 3300042605 Ga0466716_278916 Ga0466716_278916_620_1603 327
67 3300042612 Ga0466705_499005 Ga0466705_499005_2768_3751 327
68 3300042616 Ga0466715_363781 Ga0466715_363781_598_1581 327
69 3300042620 Ga0466728_096900 Ga0466728_096900_4901_5884 327
70 3300042621 Ga0466729_156825 Ga0466729_156825_1103_2086 327
71 3300042659 Ga0466733_215256 Ga0466733_215256_9186_10169 327
72 iso_pr_bacteria 2820736622 2820736669 327
73 iso_pr_bacteria 2820740053 2820740783 327
74 3300002462 JGI24702J35022_10000040 JGI24702J35022_1000004048 328
75 3300042614 Ga0466712_164773 Ga0466712_164773_348_1334 328
76 3300042620 Ga0466728_043092 Ga0466728_043092_1431_2417 328
77 3300042636 Ga0466703_164345 Ga0466703_164345_546_1532 328
78 3300042619 Ga0466726_297935 Ga0466726_297935_6157_7146 329
79 3300042602 Ga0466713_090832 Ga0466713_090832_376_1368 330
80 3300042605 Ga0466716_154063 Ga0466716_154063_1222_2214 330
81 3300042616 Ga0466715_396858 Ga0466715_396858_2163_3155 330
82 3300010167 Ga0123353_10100014 Ga0123353_101000143 331
83 3300042603 Ga0466714_163280 Ga0466714_163280_493_1488 331
84 3300042606 Ga0466719_135924 Ga0466719_135924_729_1724 331
85 3300042590 Ga0466690_130420 Ga0466690_130420_3561_4559 332
86 3300042615 Ga0466711_084790 Ga0466711_084790_6919_7920 333
87 3300005201 Ga0072941_1125529 Ga0072941_11255297 334
88 3300042606 Ga0466719_447284 Ga0466719_447284_23_1030 335
89 3300042616 Ga0466715_394361 Ga0466715_394361_16185_17219 335
90 3300042624 Ga0466735_106211 Ga0466735_106211_1817_2824 335
91 3300042659 Ga0466733_220562 Ga0466733_220562_8427_9434 335
92 3300042590 Ga0466690_104609 Ga0466690_104609_390_1403 337
93 3300042599 Ga0466706_027307 Ga0466706_027307_6766_7779 337
94 3300042599 Ga0466706_189508 Ga0466706_189508_4767_5780 337
95 3300042620 Ga0466728_286718 Ga0466728_286718_277_1290 337
96 3300042659 Ga0466733_077031 Ga0466733_077031_680_1693 337
97 3300042603 Ga0466714_121005 Ga0466714_121005_58_1074 338
98 iso_pr_bacteria 2820768849 2820769982 338
99 iso_pr_bacteria 2820774381 2820775316 338
100 3300042599 Ga0466706_082540 Ga0466706_082540_23907_24926 339
101 3300042599 Ga0466706_271736 Ga0466706_271736_4184_5203 339
102 3300042591 Ga0466692_090043 Ga0466692_090043_907_1929 340
103 3300042599 Ga0466706_270551 Ga0466706_270551_3726_4748 340
104 3300042659 Ga0466733_199714 Ga0466733_199714_312_1334 340
105 3300042603 Ga0466714_139388 Ga0466714_139388_45_1070 341
106 3300042599 Ga0466706_167981 Ga0466706_167981_635_1669 344
107 3300042603 Ga0466714_106262 Ga0466714_106262_4130_5167 345
108 3300042619 Ga0466726_136512 Ga0466726_136512_4526_5572 348
109 3300042599 Ga0466706_243833 Ga0466706_243833_33392_34444 350
110 3300042599 Ga0466706_241205 Ga0466706_241205_5873_6928 351
111 3300042596 Ga0466696_444554 Ga0466696_444554_17439_18587 382

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01207 Dus Dihydrouridine synthase (Dus) 14 319 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.92 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.