Protein Family IF06185

Metagenome Isolate
118 Members
39 Samples
113 Scaffolds
231.92 Avg Length

🧬 Representative Sequence

ID
3300042603|Ga0466714_038080|Ga0466714_038080_4385_5230
Length
281 aa
Sequence
MGKDKLRRFAENLTFDNMVQPSFDEIFHRDHALKGRWTADFFGAGPANGSDGDNPGSDTDKSDRTTTPGKPLVLELGCGKGEYTVGLGAANPDRNFLGIDIKGARMWRGAKTASELGLKNVGFLRTRIEFINSFFGPGEVSEIWITFPDPQLKKGREKKRLTSPVFLAYYAQFLAPDGVIHLKTDSREVHDYTRRVIEANALPCEACSEDISGVGAHPSAKADGNEPDDFSSHRELIPSDMKTLTSIQTAYERRFLEEGKPITYLRFRLPTDKIKFDDLVI

📊 Sample Types

Isolate 4.2%
Metagenome 95.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.1%
Termitidae 29.7%
Unclassified 16.2%
Rhinotermitidae 5.4%
Passalidae 5.4%
Termopsidae 5.4%
Hodotermitidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
2 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
3 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
8 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
9 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
13 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
14 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
15 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
25 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
26 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
27 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
32 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
35 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
36 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
37 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
38 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_069055 3300042659 Bacteria 3327
2 Ga0466715_145966 3300042616 Unclassified 1366
3 Ga0466706_062858 3300042599 Bacteria 29571
4 Ga0466706_080846 3300042599 Bacteria 4735
5 Ga0466706_167997 3300042599 Bacteria 1118
6 Ga0466714_051709 3300042603 Bacteria 2685
7 Ga0466714_075993 3300042603 Bacteria 8764
8 Ga0123353_10000340 3300010167 Bacteria 57301
9 Ga0123353_11262090 3300010167 Unclassified 963
10 Ga0466733_078922 3300042659 Bacteria 6221
11 Ga0466733_172733 3300042659 Bacteria 4190
12 2227169711 2225789004 Bacteria 8216
13 IMNBL1DRAFT_c0034854 3300000062 Bacteria 1784
14 Ga0466703_409084 3300042636 Bacteria 6789
15 Ga0466708_268802 3300042652 Bacteria 6310
16 Ga0466711_141717 3300042615 Bacteria 15726
17 Ga0466723_356706 3300042618 Bacteria 6493
18 Ga0466726_012659 3300042619 Bacteria 9514
19 Ga0466728_311970 3300042620 Bacteria 3523
20 Ga0466700_428863 3300042600 Bacteria 1028
21 Ga0466714_131715 3300042603 Bacteria 2425
22 Ga0466719_280972 3300042606 Bacteria 5448
23 Ga0123354_10030086 3300010882 Bacteria 8532
24 Ga0265387_1011047 3300024582 Bacteria 1236
25 Ga0466690_026962 3300042590 Bacteria 15786
26 Ga0466690_034574 3300042590 Bacteria 15477
27 Ga0466690_418215 3300042590 Bacteria 1085
28 Ga0466733_039484 3300042659 Bacteria 48204
29 2227474618 2225789004 Bacteria 23109
30 JGI24698J34947_10048632 3300002449 Bacteria 2146
31 Ga0466703_093296 3300042636 Bacteria 8008
32 Ga0466705_474341 3300042612 Bacteria 80430
33 Ga0466711_118539 3300042615 Bacteria 6579
34 Ga0466723_224690 3300042618 Bacteria 20701
35 Ga0466728_244893 3300042620 Bacteria 24303
36 Ga0466706_011507 3300042599 Bacteria 6611
37 Ga0466713_070860 3300042602 Bacteria 2567
38 Ga0466714_013515 3300042603 Bacteria 22119
39 Ga0466714_032897 3300042603 Bacteria 3375
40 Ga0466714_078588 3300042603 Bacteria 41151
41 Ga0466714_094964 3300042603 Bacteria 18324
42 Ga0466716_097465 3300042605 Bacteria 5227
43 Ga0466722_209370 3300042609 Bacteria 5651
44 Ga0466691_111597 3300042593 Bacteria 6352
45 JGI24705J35276_12237615 3300002504 Bacteria 12103
46 Ga0072941_1045072 3300005201 Bacteria 18963
47 Ga0466715_530650 3300042616 Bacteria 14492
48 Ga0466723_118138 3300042618 Bacteria 5956
49 Ga0466723_358260 3300042618 Bacteria 6006
50 Ga0466706_007365 3300042599 Bacteria 15970
51 Ga0466706_221740 3300042599 Bacteria 1998
52 Ga0466714_153823 3300042603 Bacteria 20213
53 Ga0466716_077930 3300042605 Bacteria 1651
54 Ga0466690_236027 3300042590 Bacteria 3255
55 Ga0466692_184583 3300042591 Bacteria 1133
56 Ga0466691_037168 3300042593 Bacteria 2923
57 Ga0466691_103514 3300042593 Bacteria 21087
58 Ga0466696_379594 3300042596 Bacteria 7192
59 Ga0466733_016994 3300042659 Bacteria 2873
60 IMNBL1DRAFT_c0000147 3300000062 Bacteria 63194
61 Ga0466708_343899 3300042652 Bacteria 24559
62 Ga0466715_311269 3300042616 Bacteria 9082
63 Ga0466714_024013 3300042603 Bacteria 3992
64 Ga0466714_094317 3300042603 Bacteria 1856
65 Ga0466719_022961 3300042606 Bacteria 3090
66 Ga0466721_273873 3300042608 Bacteria 2954
67 Ga0123353_10576288 3300010167 Bacteria 1616
68 Ga0466690_090860 3300042590 Bacteria 14173
69 Ga0466696_102295 3300042596 Bacteria 4407
70 Ga0466696_144037 3300042596 Bacteria 12558
71 Ga0466733_030120 3300042659 Bacteria 4545
72 Ga0466733_038217 3300042659 Bacteria 9446
73 IMNBL1DRAFT_c0055636 3300000062 Bacteria 1218
74 Ga0466703_178721 3300042636 Bacteria 4856
75 Ga0466705_489563 3300042612 Bacteria 9658
76 Ga0466711_077181 3300042615 Bacteria 3357
77 Ga0466723_023043 3300042618 Bacteria 8633
78 Ga0466714_003486 3300042603 Bacteria 4381
79 Ga0466714_077407 3300042603 Bacteria 1598
80 Ga0466719_034933 3300042606 Bacteria 1648
81 Ga0123353_10018824 3300010167 Bacteria 10232
82 Ga0466691_033641 3300042593 Bacteria 7880
83 JGI24702J35022_10020053 3300002462 Bacteria 3633
84 Ga0466709_279392 3300042648 Bacteria 3466
85 Ga0466708_141958 3300042652 Bacteria 25092
86 Ga0466715_409439 3300042616 Bacteria 1811
87 Ga0466706_017337 3300042599 Bacteria 2242
88 Ga0466706_170467 3300042599 Bacteria 24874
89 Ga0466714_045867 3300042603 Bacteria 4077
90 Ga0466714_076129 3300042603 Bacteria 1254
91 Ga0466714_150533 3300042603 Bacteria 1193
92 Ga0466719_476033 3300042606 Bacteria 1315
93 Ga0123353_10000700 3300010167 Bacteria 40978
94 Ga0466692_070158 3300042591 Bacteria 14151
95 Ga0466691_125533 3300042593 Bacteria 3254
96 Ga0466733_000710 3300042659 Bacteria 2113
97 Ga0466733_205096 3300042659 Bacteria 4019
98 IMNBL1DRAFT_c0007388 3300000062 Bacteria 5793
99 IMNBL1DRAFT_c0025355 3300000062 Bacteria 2276
100 Ga0466727_097686 3300042655 Bacteria 8640
101 Ga0466715_030204 3300042616 Bacteria 32308
102 Ga0466723_232010 3300042618 Bacteria 6251
103 Ga0466728_132211 3300042620 Bacteria 29619
104 Ga0466728_186745 3300042620 Bacteria 7962
105 Ga0466706_057997 3300042599 Bacteria 77163
106 Ga0466714_038080 3300042603 Bacteria 7467
107 Ga0466714_096562 3300042603 Bacteria 1527
108 Ga0466714_101157 3300042603 Bacteria 1661
109 Ga0466716_174456 3300042605 Bacteria 3307
110 Ga0123356_10002774 3300010049 Unclassified 18602
111 Ga0123353_10117904 3300010167 Bacteria 4270
112 Ga0466656_179939 3300042550 Bacteria 1377
113 Ga0466690_035961 3300042590 Bacteria 3798

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_097686 Ga0466727_097686_2045_2692 215
2 3300042636 Ga0466703_178721 Ga0466703_178721_1911_2561 216
3 3300042590 Ga0466690_236027 Ga0466690_236027_688_1344 218
4 3300042602 Ga0466713_070860 Ga0466713_070860_1299_1955 218
5 3300042606 Ga0466719_476033 Ga0466719_476033_410_1066 218
6 3300042609 Ga0466722_209370 Ga0466722_209370_3362_4018 218
7 3300042615 Ga0466711_077181 Ga0466711_077181_186_842 218
8 3300042620 Ga0466728_132211 Ga0466728_132211_8946_9602 218
9 3300042620 Ga0466728_186745 Ga0466728_186745_2174_2830 218
10 3300042596 Ga0466696_144037 Ga0466696_144037_6187_6846 219
11 3300042606 Ga0466719_280972 Ga0466719_280972_1574_2233 219
12 3300042636 Ga0466703_409084 Ga0466703_409084_2091_2750 219
13 3300042593 Ga0466691_103514 Ga0466691_103514_2628_3290 220
14 3300042605 Ga0466716_174456 Ga0466716_174456_2103_2765 220
15 3300042618 Ga0466723_118138 Ga0466723_118138_4874_5536 220
16 3300042618 Ga0466723_358260 Ga0466723_358260_4071_4733 220
17 3300010167 Ga0123353_10000700 Ga0123353_1000070021 221
18 3300042590 Ga0466690_035961 Ga0466690_035961_401_1066 221
19 3300042616 Ga0466715_530650 Ga0466715_530650_4169_4834 221
20 3300042618 Ga0466723_232010 Ga0466723_232010_1172_1837 221
21 3300042648 Ga0466709_279392 Ga0466709_279392_873_1538 221
22 3300042652 Ga0466708_343899 Ga0466708_343899_23119_23784 221
23 3300042593 Ga0466691_037168 Ga0466691_037168_326_994 222
24 3300042605 Ga0466716_077930 Ga0466716_077930_767_1435 222
25 3300042616 Ga0466715_030204 Ga0466715_030204_6749_7417 222
26 iso_pr_bacteria 2820748953 2820750008 222
27 iso_pr_bacteria 2820772500 2820773139 222
28 iso_pr_bacteria 2820781750 2820782129 222
29 3300002504 JGI24705J35276_12237615 JGI24705J35276_122376157 223
30 3300010049 Ga0123356_10002774 Ga0123356_1000277410 223
31 3300010167 Ga0123353_10018824 Ga0123353_100188243 223
32 3300010167 Ga0123353_10576288 Ga0123353_105762883 223
33 3300010167 Ga0123353_11262090 Ga0123353_112620902 223
34 3300042596 Ga0466696_102295 Ga0466696_102295_1137_1808 223
35 3300010167 Ga0123353_10117904 Ga0123353_101179042 224
36 3300042590 Ga0466690_034574 Ga0466690_034574_4497_5171 224
37 3300042593 Ga0466691_111597 Ga0466691_111597_1533_2207 224
38 3300002462 JGI24702J35022_10020053 JGI24702J35022_100200533 225
39 3300042608 Ga0466721_273873 Ga0466721_273873_1869_2546 225
40 3300000062 IMNBL1DRAFT_c0034854 IMNBL1DRAFT_00348541 226
41 3300042659 Ga0466733_069055 Ga0466733_069055_2528_3229 226
42 2225789004 2227169711 2227583495 228
43 3300042612 Ga0466705_489563 Ga0466705_489563_1674_2360 228
44 3300042590 Ga0466690_026962 Ga0466690_026962_3119_3808 229
45 3300042615 Ga0466711_118539 Ga0466711_118539_5377_6066 229
46 2225789004 2227474618 2227924866 230
47 3300042591 Ga0466692_184583 Ga0466692_184583_346_1038 230
48 3300042599 Ga0466706_057997 Ga0466706_057997_29659_30351 230
49 3300042606 Ga0466719_022961 Ga0466719_022961_228_920 230
50 3300042618 Ga0466723_023043 Ga0466723_023043_649_1341 230
51 3300042659 Ga0466733_038217 Ga0466733_038217_7740_8432 230
52 3300000062 IMNBL1DRAFT_c0025355 IMNBL1DRAFT_00253553 231
53 3300042590 Ga0466690_090860 Ga0466690_090860_11983_12678 231
54 3300042590 Ga0466690_418215 Ga0466690_418215_247_942 231
55 3300042593 Ga0466691_033641 Ga0466691_033641_5509_6204 231
56 3300042606 Ga0466719_034933 Ga0466719_034933_117_812 231
57 3300042615 Ga0466711_141717 Ga0466711_141717_14640_15335 231
58 3300042616 Ga0466715_145966 Ga0466715_145966_160_855 231
59 3300042616 Ga0466715_409439 Ga0466715_409439_982_1677 231
60 3300042618 Ga0466723_224690 Ga0466723_224690_18133_18828 231
61 3300042618 Ga0466723_356706 Ga0466723_356706_1498_2193 231
62 3300042652 Ga0466708_141958 Ga0466708_141958_22252_22947 231
63 3300000062 IMNBL1DRAFT_c0007388 IMNBL1DRAFT_00073881 232
64 3300042593 Ga0466691_125533 Ga0466691_125533_1621_2319 232
65 3300042603 Ga0466714_024013 Ga0466714_024013_3011_3712 233
66 3300042603 Ga0466714_045867 Ga0466714_045867_3123_3824 233
67 3300042619 Ga0466726_012659 Ga0466726_012659_6232_6933 233
68 3300042620 Ga0466728_311970 Ga0466728_311970_361_1062 233
69 3300042599 Ga0466706_007365 Ga0466706_007365_4277_4981 234
70 3300042620 Ga0466728_244893 Ga0466728_244893_15885_16589 234
71 3300042636 Ga0466703_093296 Ga0466703_093296_2641_3345 234
72 3300042659 Ga0466733_016994 Ga0466733_016994_2142_2846 234
73 3300042599 Ga0466706_017337 Ga0466706_017337_1315_2022 235
74 3300042599 Ga0466706_167997 Ga0466706_167997_179_886 235
75 3300042603 Ga0466714_075993 Ga0466714_075993_7788_8495 235
76 3300042603 Ga0466714_131715 Ga0466714_131715_822_1529 235
77 3300042659 Ga0466733_039484 Ga0466733_039484_21884_22591 235
78 3300024582 Ga0265387_1011047 Ga0265387_10110471 236
79 3300042616 Ga0466715_311269 Ga0466715_311269_4204_4914 236
80 3300000062 IMNBL1DRAFT_c0000147 IMNBL1DRAFT_00001478 237
81 3300000062 IMNBL1DRAFT_c0055636 IMNBL1DRAFT_00556362 237
82 3300042599 Ga0466706_011507 Ga0466706_011507_1509_2222 237
83 3300042599 Ga0466706_062858 Ga0466706_062858_11698_12411 237
84 3300042603 Ga0466714_076129 Ga0466714_076129_506_1219 237
85 3300042550 Ga0466656_179939 Ga0466656_179939_38_754 238
86 3300042599 Ga0466706_080846 Ga0466706_080846_742_1458 238
87 3300042599 Ga0466706_221740 Ga0466706_221740_213_929 238
88 3300042603 Ga0466714_013515 Ga0466714_013515_1423_2139 238
89 3300042603 Ga0466714_051709 Ga0466714_051709_1254_1970 238
90 3300042603 Ga0466714_101157 Ga0466714_101157_170_886 238
91 3300042612 Ga0466705_474341 Ga0466705_474341_21688_22404 238
92 3300042659 Ga0466733_172733 Ga0466733_172733_3276_3992 238
93 3300042591 Ga0466692_070158 Ga0466692_070158_2050_2769 239
94 3300042605 Ga0466716_097465 Ga0466716_097465_1962_2681 239
95 3300042659 Ga0466733_000710 Ga0466733_000710_659_1378 239
96 3300042659 Ga0466733_078922 Ga0466733_078922_2530_3249 239
97 3300042599 Ga0466706_170467 Ga0466706_170467_23624_24346 240
98 3300042603 Ga0466714_094964 Ga0466714_094964_9913_10635 240
99 3300042603 Ga0466714_153823 Ga0466714_153823_4988_5710 240
100 iso_pr_bacteria 2820768849 2820770345 240
101 iso_pr_bacteria 2820774381 2820775548 240
102 3300010167 Ga0123353_10000340 Ga0123353_100003404 241
103 3300042603 Ga0466714_150533 Ga0466714_150533_270_995 241
104 3300042603 Ga0466714_032897 Ga0466714_032897_2599_3327 242
105 3300042603 Ga0466714_077407 Ga0466714_077407_638_1366 242
106 3300042603 Ga0466714_096562 Ga0466714_096562_163_894 243
107 3300010882 Ga0123354_10030086 Ga0123354_100300867 244
108 3300002449 JGI24698J34947_10048632 JGI24698J34947_100486323 246
109 3300042603 Ga0466714_003486 Ga0466714_003486_1099_1842 247
110 3300042652 Ga0466708_268802 Ga0466708_268802_1179_1922 247
111 3300042596 Ga0466696_379594 Ga0466696_379594_6370_7116 248
112 3300042600 Ga0466700_428863 Ga0466700_428863_97_843 248
113 3300042659 Ga0466733_030120 Ga0466733_030120_1259_2011 250
114 3300005201 Ga0072941_1045072 Ga0072941_104507218 251
115 3300042659 Ga0466733_205096 Ga0466733_205096_2033_2800 255
116 3300042603 Ga0466714_094317 Ga0466714_094317_948_1721 257
117 3300042603 Ga0466714_078588 Ga0466714_078588_33150_33932 260
118 3300042603 Ga0466714_038080 Ga0466714_038080_4385_5230 281

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13847 Methyltransf_31 Methyltransferase domain 73 130 0.94
PF02390 Methyltransf_4 Putative methyltransferase 70 200 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.